javcensored uniform censored voyeur amateur




FC2CJODAUKGNACRATIDVEMAWAAAFSDSSHMNDASDMEYDJUFEEBODAMBIAPODJULAWDSTARSSANHDKANNPJ

2020-09-13
41 min

FC2PPV 1500862 * First shot [with purchase privilege & review privilege] Active cabaret girl Kanon-chan 19 years old ♡ After-sales is a love hotel and vaginal cum shot rich SEX ☆ Cheeky gal who is good at pillow sales is de M-chan! part1 * Uncens

  • amateur uncensoredfc2
    • 2020-09-25
    61 min

    Caribbeancom 092520-001 No Sex Patience Championship Riina Okamoto

  • riina okamoto uncensoredcreampienursecaribbeancom
    • 2020-10-09
    86 min

    [hoi-133]夏(22)

  • amateur censoredamateurbeautiful girlhoihoi-133hoi133hoi-133
    • 2020-10-09
    36 min

    [TG-078](Self-Shot) G-Cup Girl Who Loves To Suck. Two Loads For Her Blowjob And Sensitive Pussy

  • censoredbig titsamateurTG1059 tokyoTG-078TG078h-1304tg00078
    • 2020-10-15
    63 min

    [orex-200]くるみ 2

  • amateur censoredcreampiebig titsorexorex-200orex200orex-200
    • 2020-10-29
    78 min

    AVKH-182 Ninomiya Satomi

  • amateur censoredbig titsamateuravkhavkh-182avkh182avkh-182
    • 2020-11-13
    147 min

    [EBOD-783]My Female Boss Turned Into A Total Slut With A Little Liquor - Made To Service Her Until Dawn With Creampie Overtime At The Office Chitose Yuki

  • chitose in the evening censoredblowjobbeautiful girlEBODe bodyichigoharaEBOD-783EBOD783ebod00783
    • 2020-11-24
    40 min

    FC2PPV 1582030 [Limited quantity 2980pt → 1980pt] Bottomless libido monster beauty member Yuko ❤️ Night crawling play after staying erotic massage ❤️ Please help erotic activities because I can not handle it alone ❤️ Purchase privilege is 3 past work

  • amateur uncensoredfc2
    • 2020-11-29
    128 min

    [KTKL-090]A Lolita Dick-Sucking Little Devil Slut Hinako "I Get Excited When I Put Men In Embarrassing Situations"

  • censoredcreampieslutKTKLkitixx mousouzokuloliconKTKL-090KTKL090ktkl00090
    • 2020-12-11
    44 min

    FC2PPV 1602802 [Personal shooting] Infiltrate a secret orgy ㉒ Chubby lewd child ♥ Inject Ossan sperm one after another with a vaginal cum shot ♪ * High quality version & review benefits included ♪

  • amateur uncensoredfc2
    • 2020-12-23
    16 min

    Caribbeancom 122320-001 The Undisclosed: Tit fxxk heaven Chiaki Hidaka

  • chiaki hidaka uncensoredhandjobcaribbeancom
    • 2020-12-25
    56 min

    FC2PPV 1620164 [First time limited 1980] Serious beautiful wife who usually works at Su ○○ station ❤️ Actually it was sexless for 6 years ❤️ A married woman who is hungry for libido is rolled up with an electric massage machine, a vibrator and anothe

  • amateur uncensoredfc2
    • 2021-01-01

    10musume 010121_02 Never Ending Self Deep Throating Sanae Kiuchi

  • amateur uncensored10musume
    • 2021-01-08
    183 min

    [NHDTB-478]Annual Custom - Private School Senior's Culture Festival Booth Is Secretly A Swinger's Club

  • censoredschoolgirlNHDTBnatural highlemonheart nakajimaNHDTB-478NHDTB4781nhdtb00478
    • 2021-01-30
    53 min

    FC2PPV 1666005 ★ Amateur wife ☆ Nympho wife who scatters breast milk ♥ Michiyo re-advents ☆ Excited to take a breast milk shower ♥ Jurjuru breastfeeding play ♥ Electric squirting nympho mom ♥ Raw squirting creampie ejaculation ♥ [Personal shooting] *

  • amateur uncensoredfc2
    • 2021-02-03
    77 min

    259LUXU-1371 Luxury TV 1361 A beautiful singer with beautiful big tits is here! If you insert a big cock into the vagina that has become thick with caress, you will accept it with a fascinating expression, and you will also expose your bewitching app

  • amateur censoredbig titsamateurluxuluxu-1371luxu1371259luxu-1371
    • 2021-02-12
    68 min

    [ZOZO-043]Miss Asaka Sera

  • censoredcreampiebig titsZOZOsadie willenauZOZO-043ZOZO0431zozo00043
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-26
    78 min

    300MAAN-628 [Unconscious little devil girl / maid clothes x Gonzo / Creampie & Facials] Moe voice of Lori system x Mechakawa girls bar clerk who naturally tosses a man with a good eye! !! It’s a neat and clean JD with a perfect appearance an

  • amateur censoredcreampieamateurmaanmaan-628maan628300maan-628
    • 2021-02-27
    72 min

    476MLA-030 Prickets Geki Echi Campaign Girl catches cum shot juice in the womb! !! Transcendent grind cowgirl who hits the tip of the chin on Portio and goes crazy! Sea pick-up ⇒ Saffle ⇒ Record summer memories with Gonzo ☆ Wheat-colored BODY 3 shots

  • amateur censoredcreampiesquirtingmlamla-030mla030476mla-030
    • 2021-02-27
    240 min

    [MCSR-427]Amazing Married Women Get Dirty In Front Of Their Husbands... - 4 Hours

  • takarada monami an sasakura censoredcreampiebig titsMCSRbig morkaljiro kanekomascottMCSR-427MCSR42757mcsr00427
    • 2021-03-01
    70 min

    326PAPA-028 [Daddy activity infiltration, Aimi-chan edition] F cup whitening milk trimmer GET with the super famous daddy activity application “Shi ● Gada ● i” ☆ Make clear pure white skin flush and shoot in the mouth & cum shot 2 conse

  • amateur censoredcreampieamateurpapapapa-028papa028326papa-028
    • 2021-03-19
    99 min

    [VENX-017]Step Son Becomes Guinea Pig For Step Mother Becoming A Prostitute Maho Kanno

  • maho kanno censoredcreampiebig titsVENXvenussarufakecest winntersVENX-017VENX017venx00017
    • 2021-03-19
    100 min

    [VEC-470]My Friend's Mother And Me I Fucked Her Raw And Came Inside Of Her... Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiemature womanVECvenuspetermegami venusVEC-470VEC470vec00470
    • 2021-03-19
    142 min

    [TNOZ-003]Titanic Tits: Rural Cosplayer (Age 19) With A Submissive Streak (Everybody Gets A Titty & Nipple Fuck & Cums On Her Tits) P-Cup With Enormous Nipples Ravished By 12 Continuous Loads In A Titty Fuck Four-Some Orgy, Spitroasted By 2 Guy

  • censoredbig titscosplayTNOZall japan amateur photographers union daspit uncle 2 all japan kameko cooperatiTNOZ-003TNOZ003tnoz00003
    • 2021-03-26
    110 min

    483SGK-019 [18-year-old young supernova] [Super big pie G soft milk] [Great big ass] [Continuous pursuit super creampie] [No runaway convulsions Ikipa] Erotic erotic too erotic! 18-year-old Pichi Pichi super new star gal invades! !! !! If the big bre

  • rgal censoredcreampiebig titssgksgk-019sgk019483sgk-019
    • 2021-04-01
    70 min

    FC2PPV 1750583 [Individual shooting] ＃ 45 Idol face ass J 〇 and after-school sex Premature ejaculation with too good sensitivity 〇 Plenty of raw chicks in and out [Leaked] [Limited]

  • amateur uncensoredfc2
    • 2021-04-02
    78 min

    383REIW-053 Saya

  • amateur censoredamateurreiwreiw-053reiw053383reiw-053
    • 2021-06-02
    125 min

    [ARMF-017]Beautiful Secretary: Full Body Encyclopedia No.1

  • kiriyama yuu kasagi ichika censoredanalARMFaroma planningfemale body fetishismARMF-017ARMF017armf00017
    • 2021-06-04
    124 min

    [NKKD-212]Married Woman Is Enticed By The Naughty Wives Of The Neighborhood And Made To Register Her Name In The Secret Apartment Block Prostitution Circle Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanNKKDjet eizomanji groupNKKD-212NKKD212nkkd00212
    • 2021-06-04
    170 min

    [DVDMS-673]A Normal Boys And Girls Focus Group Adult Video Everyone's Favorite Big Tits Female Managers Only! During Training Camp, Would You Go Into The Men's Bath And Take Care Of The Team Members' Cocks By Using Your Big Tits And Givin

  • censoredcreampiebig titsDVDMSdeep ssuttorune iwanagaDVDMS-673DVDMS673dvdms00673
    • 2021-06-05
    117 min

    [MKD-227]The AV Debut Of A Devilishly Beautiful 50-something Woman With F-cups! Rinka Satsuki

  • rinka satsuki censoredbig titsmature womanMKDrubyMKD-227MKD227mkd00227
    • 2021-06-11
    82 min

    300MIUM-715 Apparel Clerk Spree Spree 8 Times A Week! !! Ma ● Ko is tight, but the guard is Yuruyuru! !! !! [Pleasure enthusiast who loves sex with tight ass & beautiful breasts! !! ] × [Transcendental sensitive minimalist who squirts immediately

  • amateur censoredamateurmiummium-715mium715300mium-715
    • 2021-06-16
    148 min

    [PPPD-933]I Missed The Last Train Home After A Work Party And When My Busty Coworker Whispered "Wanna Come Back To My Place？" In My Ear I Couldn't Resist The Temptation. She Seduced Me With Her Cleavage And We Banged. Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsPPPDoppaiPPPD-933PPPD933pppd00933
    • 2021-06-30
    28 min

    FC2PPV 1895171 [Exclusive] Former Saffle Reading Mo Bishoujo Iroha

  • amateur uncensoredfc2
    • 2021-07-02
    34 min

    520SSK-012 Erika

  • amateur censoredcreampiesquirtingsskssk-012ssk012520ssk-012
    • 2021-07-03
    97 min

    [VENX-055]Tall And Shameful! Step Mother In High Socks Gets Filled With Cum ~ My New Step Mom Is Taller Than Me ~ Waka Haruna

  • haruna waka censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-055VENX055venx00055
    • 2021-07-03
    50 min

    210AKO-432 AIRI

  • amateur censoredamateurnurseakoako-432ako432210ako-432
    • 2021-07-08
    155 min

    [278GYAN-017]股がユルいってレベルじゃねーぞ！新卒OLは勤務中SEX当たり前w 24時間所構わずパコリまくる色キチあたおか露出動画を刮目せよッ！ 森日向子

  • amateur censoredamateurgyangyan-017gyan017278gyan-017
    • 2021-08-21
    42 min

    362SCOH-055 [Creampie] Let A Carefully Selected Beautiful Girl Cosplay And Conceive My Child! [D] Rear 2] Rika Aimi

  • amateur censoredcreampieamateurscohscoh-055scoh055362scoh-055
    • 2021-09-09
    120 min

    [FSDSS-282]Secret Forbidden Orgasm SEX At School With Soft Spoken Teacher Ms.Amakawa. Sora Amakawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenotonkatsufaleno starFSDSS-282FSDSS2821fsdss00282
    • 2021-09-17
    39 min

    FC2PPV 2213956 [No] [Limited To 100 Pieces, Off From 2980 To 1480pt!] Beautiful Beauty Member Who Looks Elegant ♥ ️ Vulgar De Metamorphosis When You Take It Off ♥ ️ Under-Processed ♥ ️ * Review Privilege / High Image Quality Ver.

  • amateur uncensoredfc2
    • 2021-09-18
    47 min

    500DPL-0033 AV Debut! Furthermore, Sudden Vaginal Cum Shot! Yoshino Yuki 27 Years Old

  • amateur censoredcreampieamateurdpldpl-0033dpl0033500dpl-0033
    • 2021-10-15
    184 min

    [MIDE-980]A Non-Nude Erotica Image Idol Makes An Outrageous Announcement! She"s Got 10,000 Followers And Now She"s Making Her Adult Video Debut!! A Full Video Record Of The Approximately 180 Days Since She Announced Her Adult Video Performanc

  • flower bud alice censoredbeautiful girlsingle workMIDEmoodyzusapyonmoodyz divaMIDE-980MIDE980mide00980
    • 2021-10-20
    98 min

    435MFC-151 ["God" Body Line X Squeezing Climax] Big Pie / Big Bucket Transcendental Beauty Body Beauty And Libido Open Raw Saddle Fully Open Sex! "I’M Full, But I Can’T Stop ♪" Continuous Ascension With A Merciless Uterine

  • amateur censoredcreampieamateurmfcmfc-151mfc151435mfc-151
    • 2021-10-29
    21 min

    FC2PPV 2384199 [Full View For A Limited Time] While Watching The Demon Shikoyari Man Gal In The Parking Lot, Pakopako Sns Winner And Slimy Shikoshiko

  • amateur uncensoredfc2
    • 2021-11-02
    59 min

    SIRO-4694 [First Shot] [Beautiful Breasts X Nice Ass] [Enchanted Lingerie] An Underwear Shop Clerk Who Wears Sexy Underwear With A Mature And Bewitching Atmosphere Appears. Shake Violently While Taking Pictures Of Beautiful Breasts And Nice Ass That

  • amateur censoredamateursirosiro-4694siro4694siro-4694
    • 2021-11-04
    257 min

    [CUBEX-009]Giving In To Raw Fucking Collection 9 (Amazing K, I, And H-cup) Hot And Super Lewd Colossal Tits On This Wife. Those Big Tits Shake All Over While She Gets Fucked For A Heavy Creampie Load. Infidelity Footage! 4 Hours.

  • censoredcreampiebig titsCUBEXcubecube cubeCUBEX-009CUBEX009h-1593cubex00009
    • 2021-11-09
    65 min

    Pacopacomama 110921_556 Exotic Look And Obscene Areola Sumire Egawa

  • amateur uncensoredpacopacomama
    • 2021-11-27
    71 min

    C0930 tk0047 Yuuna Nagashiro 27years old

  • amateur uncensoredc0930
    • 2021-11-29
    39 min

    FC2PPV 2473732 [No Eye Moza] Attached Female General Course ③ Small Devil Honor Student And First-Time Student * Final Addition

  • amateur uncensoredfc2
    • 2021-12-02
    64 min

    [REBD-607]Suzu 5 Elegance And Wildness. Suzu Honjo

  • suzu honjo censoredsingle workREBDrebeccaherpes takaREBD-607REBD607h-346rebd00607
    • 2021-12-04
    119 min

    [SCD-200]Cheating on My Fiancee During Our Engagement Trip Shiori Tsukada

  • shiori tsukada censoredcreampiemature womanSCDrubykatsumoku saburousecret rubiSCD-200SCD200scd00200
    • 2021-12-14
    142 min

    1Pondo 121421_001 Special Edition Emi Sakurai Emi Sakurai

  • amateur uncensored1pondo
    • 2021-12-21
    40 min

    FC2PPV 2534088 "How Many Cups Do You Have？" Miraculous Lori Huge Breasts Found In Front Of Hello Work, After Two Times In The Car, Stunned By The No-Hand Ejaculation That Holds The Chest Like Kyoho Fruit In The Car In The Daytime While Being

  • amateur uncensoredfc2
    • 2021-12-23
    57 min

    10musume 122321_01 A Girl is Scribbled All Over Her Body but She Still Gets Horny Rikako Yamada

  • amateur uncensored10musume



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored