kanade




FC2ABWRBDAUKGHNDCAWDAVSAADNFSDSSVEMASPRDSANAPODAWDEBODWANZIPXCHRVMARAVENUMIDV

2020-10-09
158 min

[SCOP-688]I'm A Popular Delivery Health Call Girl, And The Customers Never Stop Asking For Me. I'm Keeping My Job A Secret From My Husband, But When My Neighbor Found Out... He Blackmailed Me And Said, "If You Don't Want Me To Tell Yo

  • censoredcreampiebig titsSCOPscoopkuwattimousouzokuSCOP-688SCOP688h-565scop00688
    • 2020-11-03
    96 min

    451HHH-012 AV first experience [Non-standard de M] [Transcendence slender legs] [Muddy swamp SEX] Strangling, restraint, spanking … A record of a neat and clean de M beautiful girl who loves painful things drowning in Drodro’s sex and cryin

  • amateur censoredamateurhhhhhh-012hhh012451hhh-012
    • 2020-11-06
    50 min

    417SRCN-047 Plump F Breasts Flasher J ● Discovered! !! Sneaking up on J ● who enjoys a fiercely dangerous propensity after school and leaking Dada with shame excitement Ma ● Ko is shaken big tits with a demon piss and cum shot raw!

  • amateur censoredcreampiebig titssrcnsrcn-047srcn047417srcn-047
    • 2020-11-29
    148 min

    [LULU-047]"Your Dick Is So Bundled Up! I'm Going To Peel You And Make You Nice And Clean" My Big Tits Big Stepsister Works For A Bathhouse And She Started Cleaning My Uncircumcised Cock And Then She Used Her Sexy Body To Give Me All The N

  • yu asakura censoredcreampiebig titsLULUlunaticsluminaxLULU-047LULU047lulu00047
    • 2020-12-03
    148 min

    [AKDL-069](An Amateur Interview) She's Performing In This Adult Video Without Telling Her Parents She Has A Cute Name For Her Pussy This Nice Girl Is Beautiful But Bashfully Cumming For The First Time Rui 20 Years Old Occupation: Trade School S**

  • censoredamateurbeautiful girlAKDLaquinoriaquinoriaknrAKDL-069AKDL0691akdl00069
    • 2020-12-07
    39 min

    [ore-735]優香さん(26)

  • amateur censoredcreampiesquirtingoreore-735ore735ore-735
    • 2020-12-09
    50 min

    [opcyn-125]さら(20)

  • amateur censoredcreampieamateuropcynopcyn-125opcyn125opcyn-125
    • 2020-12-19
    65 min

    C0930 ki201219 gold pack 20years old

  • amateur uncensoredc0930
    • 2020-12-24
    121 min

    [GS-369]This Alluring Lady Came At You With A Reverse Night Visit Because She Was Hungry For Cock I Went On A Business Trip Out Into The Country Where There Was Absolutely Nothing To Do, So I Stayed The Night At A Hot Spring Resort Inn, Dejected And

  • censoredGSsosoru x garconspada ikebukuroGS-369GS3691gs00369
    • 2020-12-27
    240 min

    [MCSO-006]The Best Big Asses! Cumming While Being Piston Fucked Hard As Her Asshole Twitches

  • censoredMCSOmercurypremier dreamMCSO-006MCSO006h-1133mcso00006
    • 2020-12-27
    63 min

    Caribbeancom 122720-001 If My Girlfirend Is Mitsuha Kikukawa: I would be late at work everyday

  • amateur uncensoredcreampiecaribbeancom
    • 2020-12-28
    485 min

    [HMVX-005]Teens Only! Barely Legal Beautiful Girl Sold For Sex! Naughty Adolescents Offered Up For Pleasure! 10 Young Goddesses Fucked

  • censoredcreampieamateurHMVXhamedori.network secondeditionHMVX-005HMVX005h-1472hmvx00005
    • 2021-01-02
    69 min

    476MLA-026 Climax loop with outstanding sensitivity! !! Gonzo a beautiful girl with a temperament caught in Enoshima ☆

  • amateur censoredamateurmlamla-026mla026476mla-026
    • 2021-01-13
    43 min

    FC2PPV 1642758 [Appearance / Uncensored / Cheating NTR] God Fcup Beauty Witch NTRw who loves each other with super rich SEX with other married women Complete service & seeding cum shot at the woman on top posture! Cowgirl tech w of a beautiful wi

  • amateur uncensoredfc2
    • 2021-01-18
    62 min

    [tkwa-152]ゆい＆ちはる

  • amateur censoredcreampieuniformtkwatkwa-152tkwa152tkwa-152
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-27
    130 min

    390JAC-078 [G Breast Bombing Dancer x Raw Saddle 5 Barrage] Come on like R.Y.U.S.E.I. with a show bra and show pan! Natural Slut Ikeike Dancer SARA! Squirting with your favorite vibrator! Super grind with your favorite cowgirl dance! This is definite

  • amateur censoredcreampiebig titsjacjac-078jac078390jac-078
    • 2021-03-08
    103 min

    FC2PPV 1717523 ★ Price cuts as soon as stock runs out, benefits end ★ Individual lessons with real big breasts instructors ★ Problematic work that has been banned from entering erotic mode without noticing that there is a security camera in a private

  • amateur uncensoredfc2
    • 2021-03-13
    121 min

    [MUDR-143]My Little Stepsister Is A Cute GAL Real Edition My Little Stepsister Wants To Cuddle. Momo Kato ka

  • kato momoka censoredcreampiesquirtingMUDRmukuMUDR-143MUDR143mudr00143
    • 2021-03-18
    63 min

    FCP-005 [Distribution only] "What did you do？ you can not sleep？ I’ll do something comfortable and let you lie down … ”Ultimate healing erotic! Co-sleeping handjob! !! ＃ 1

  • amateur censoredbig titsamateurfcpfcp-005fcp005fcp-005
    • 2021-03-19
    143 min

    [TIKP-056]A Perverted Dirty Old Man's Fuck Videos A-tan

  • censoredcreampieschoolgirlTIKPtikitiki.comerTIKP-056TIKP056tikp00056
    • 2021-03-26
    124 min

    [CMD-032]Temptation Beauty Salon - Mao Watanabe

  • mao watanabe censoredblowjobslutCMDdream ticketCMD-032CMD03224cmd00032
    • 2021-04-14
    147 min

    [RKI-610]No. 1 Popular Escort At A Real Cosplay Sex Store Let's You Put It In! Fake Name: Mitsuha Higuchi

  • mitsuha higuchi censoredschoolgirlblowjobRKIrookietake dRKI-610RKI610rki00610
    • 2021-04-20
    92 min

    [KCK-011]Livestock Transsexual 11 Pure Masochistic Slut Is Transformed Into A Woman Churin

  • chuzawa nakazawa censoredbdsmKCKsanwa publishingclick manKCK-011KCK011h-019kck00011
    • 2021-05-01
    160 min

    [DVDMS-662]Smoking Hot Airport Security Guard Yuiko (Age 23) Makes Her Porn Debut - And Loses Her Virginity On Camera! A Working Girl's Porn Performance - This Slender, Toned Babe Has Defined Abs - 307 Days Of Passionate SEX

  • censoredamateurDVDMSdeep shikaru kamegashiraDVDMS-662DVDMS662dvdms00662
    • 2021-05-08
    180 min

    [AUKS-126]Lesbian Hangout - Old 4.5 Tatami Room - Naughty Lesbian Brothel 2 - Natsuki Nagahara Ito Sara

  • nagatsuki natsuki ito sharan censoredlesbiandramaAUKSu kroshilvia takiguchiAUKS-126AUKS126auks00126
    • 2021-05-09
    66 min

    SIRO-4513 [First shot] [Ubukawa active college student] [Desperate hip swing like a jockey] An active college student who exposed pure white skin appeared. Ubukawa beautiful girl with boyfriend echoes a high-pitched beautiful voice to the pleasure of

  • amateur censoredamateursirosiro-4513siro4513siro-4513
    • 2021-05-15
    93 min

    [SUJI-135]Manipulated According To A Man's Desires: S*****t Creampie Raw Footage Marina

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-135SUJI135suji00135
    • 2021-05-22
    47 min

    H4610 ki210523 Yoshiko Nakamura 27years old

  • amateur uncensoredh4610
    • 2021-06-24
    136 min

    [SPRD-1428]Hung Father-In-Law - Bride Keeps Banging Her Husband's Dad... Aya Shiomi

  • aya shiomi censoredsingle workSPRDtakara eizokon oriharualeddinSPRD-1428SPRD142818sprd01428
    • 2021-06-26
    111 min

    [VEMA-166]My Beautiful Female Teacher, Who Is My Homeroom Teacher, And Also Our Club Team Advisor, Is Also My Lover - Forbidden, Passionate, Creampie Sex, From Dusk 'Til Dawn, With My Older Girlfriend - Akari Neo

  • akari neo censoredcreampiebig titsVEMAvenuspetermegami venusVEMA-166VEMA166vema00166
    • 2021-07-02
    120 min

    [SHKD-957]Me, An Upper-class Citizen, Am Getting Fucked By Dirty Servants' Cocks. Nanami Kawakami

  • kawakami nanami censoredsingle workdramaSHKDattackerskitorune kawaguchisharkSHKD-957SHKD957shkd00957
    • 2021-07-03
    97 min

    200GANA-2521 A real record of how even beginners can easily take home on the same day! <Be sure to watch> You can have sex with you! !!

  • amateur censoredbig titsamateurganagana-2521gana2521200gana-2521
    • 2021-07-13
    104 min

    261ARA-497 [Geki Kawa Otaku Musume] [Sweet voice of charm] Tsumugi-chan is here! The reason for her application is "I read a naughty douujinshi and got horny ♪" The book is thin, but I’m hot w [Moe body] I was squeezed and cummed and Iki

  • amateur censoredamateuraraara-497ara497261ara-497
    • 2021-08-13
    120 min

    [ROYD-064]Usually, My Big Stepsister Is A Plain Jane With No Style, But She Decided To Show Out And Show Off Her Body, And I Lost My Mind And Ended Up Creampie Fucking Her. Minami Hatsukawa

  • hatsukawa minami censoredcreampiesisterROYDroyalkonnyaku kannohhh groupROYD-064ROYD064royd00064
    • 2021-08-20
    160 min

    [HMN-038]Snake Woman: By Possessing The Body Of A Human Female, She Licks A Lot, Mates, And Has Sex Yumi Saeki Yumika Saeki.

  • yuka saeki censoredcreampieblowjobHMNhonnakamamezawa mametarouHMN-038HMN038hmn00038
    • 2021-08-26
    485 min

    [NHDTB-569]NATURALHIGH Summer Special. Sensitive (Shameful) Big Tits Pervert 2021 Complete Edition. Sex For All 10 Performers. Hard Nipples Version. 2 Volumes, 8 Hours

  • censoredbig titssquirtingNHDTBnatural highkansukeNHDTB-569NHDTB5691nhdtb00569
    • 2021-09-18
    131 min

    [AGAV-063]The Greatest Ass - Endless Bukkake With A 95cm Pretty Ass - Rima Kawahara

  • rima kawahara censoredsingle workAGAVsex agentyoshida daibutsuAGAV-063AGAV063agav00063
    • 2021-09-30
    112 min

    420HOI-201 Natsuna (Natsuna Sasaki)

  • amateur censoredbig titssquirtinghoihoi-201hoi201hoi-201
    • 2021-10-01
    166 min

    [DROP-066]Shy Amateur Girls Get Their Bare Titties Fondled! 2

  • censoredbig titsamateurDROPoffice k sdrop office ksDROP-066DROP06636drop00066
    • 2021-10-18
    82 min

    259LUXU-1454 Luxury TV 1471 A Pianist With An Attractive Plump Glamorous Body With An Adult Sex Appeal Appears In AV In Search Of A New World! The Body That Has Begun To Ripen Sensually Is Outstandingly Sensitive! The Pant Voice That Echoes Annoyingl

  • amateur censoredbig titsamateurluxuluxu-1454luxu1454259luxu-1454
    • 2021-10-29
    119 min

    [MIDE-991]Seeing My Precious Girlfriend Being Enjoyed By The DQNs In Class Using an Aphrodisiac And Made To Have Sex With You Gives Me A Poor Erection Nana Yagi

  • nana yagi censoredsingle workMIDEmoodyzshouten shiroumoodyz divaMIDE-991MIDE991mide00991
    • 2021-11-13
    85 min

    355OPCYN-196 Yuuri (Yuri Asada)

  • amateur censoredcreampiesquirtingopcynopcyn-196opcyn196355opcyn-196
    • 2021-11-18
    92 min

    [REBD-604]Nana. Hang a Rainbow in This Sky. Nana Hayami

  • don t be quick censoredsingle workREBDrebeccachikara sawamuraREBD-604REBD604h-346rebd00604
    • 2021-11-19
    43 min

    FC2PPV 2445230 First Shot! !! Limited Number! [Uncensored] An Active Junior College Student Who Has Just Started This Year … While Assuming The Worst Situation, Giving Priority To Pleasure And Vaginal Cum Shot For The Second Time! !! The Big Scr

  • amateur uncensoredfc2
    • 2021-11-20
    240 min

    [MDBK-210]50 Of The Cutest And Most Adorable Baby Faces! Super Best! You Can"t Imagine How Erotic They Are From Their Cute Faces, And You"ll Be Hooked!

  • inaba scooping censoredcreampiecosplayMDBKbazookak taroMDBK-210MDBK210mdbk00210
    • 2021-12-04
    160 min

    [LULU-107]My Big Tits C***dhood Friend Started Working At A Reverse Bunny Club, So When I Agreed To Help Her Practice Her Work Techniques, She Gave My Prematurely Ejaculating C*ck So Much Nookie, Every Day, That My Balls Went Bone Dry. Misono Mizuhar

  • suwon miso censoredcreampiebig titsLULUlunaticsvagmanLULU-107LULU107lulu00107
    • 2021-12-10
    155 min

    [JUL-791]Wife At High Altitude Flapping Wings Into Sky of Infedility. Former International Route Cabin Attendant Married Woman Aoi Onodera 26-Years Old Porn Debut

  • aoi onodera censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-791JUL791jul00791
    • 2021-12-23
    145 min

    [STARS-491]朝ドラ系現役アイドルT〇kT〇ker 西元めいさ 小さなお口でたまきん

  • nishimoto meisa censoredsoloworkSTARSsod createakai suiseisod starSTARS-491STARS491
    • 2021-12-24
    180 min

    [SSIS-281]Frantic Cum 183 Times! Convulsions 3915 Times! 23800 Piercing Pistons! Chubby H Cup! BODY Eros Awakening! First Huge Convulsion Special! Konan Koyoi

  • koyoi konan censoredbig titssquirtingSSISs1 no 1 styleusa pyonSSIS-281SSIS281ssis00281
    • 2022-01-04
    61 min

    1Pondo 010422_001 Braless Neighbor In The Morning: Non Suzumiya

  • amateur uncensored1pondo
    • 2022-01-05
    36 min

    FC2PPV 2571330 A Beautiful Apparel Clerk Who Makes A Great Blow Job And A New Year’S Daytime Blow Job In The Car, Licking A Finger With Sperm In The No-Hand Mouth And Being Stunned By "It Was Delicious" …

  • amateur uncensoredfc2
    • 2022-01-14
    121 min

    [MVSD-495]Hard-Pounding Cuckold"s Revenge - What Would You Do If You Spotted Your Best Friend Nailing The Girl You"ve Had A Crush On Your Whole Life？ Transformed With Rage, You Wait Until He"s Out For 3 Days, And Spend The Whole Time Bang

  • akari neo censoredcreampiesquirtingMVSDm s video groupMVSD-495MVSD495mvsd00495
    • 2022-01-14
    161 min

    [MIDV-035]Big Tits Cowgirl Sex After Abstinence My Horny C***dhood Friend (She"s 1 Year Older Than Me) Had Broken Up With Her Boyfriend, And Now She"s Cum Back Home To The Country And Riding Me Like A Bull And Fucking Me Every Day Fumika Naka

  • nakayama fumika censoredbig titsblowjobMIDVmoodyztrendy yamaguchimoodyz divaMIDV-035MIDV035midv00035
    • 2022-01-15
    126 min

    [DDFF-019]Heinous Throat Wedding Planner - Iroha Minami

  • minami iroha censoredcreampiedeepthroatDDFFdogmafk2DDFF-019DDFF019ddff00019
    • 2022-01-22
    130 min

    [AGMX-107]Saliva Deep Kiss, Nipple Licking Sixty Nine

  • mizuki yayoi riho takahashi censoredblowjobhandjobAGMXsex agent daydreamersdaibutsu yoshidasex agentAGMX-107AGMX107agmx00107



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored