massage refre uniform high vision censored javcensored




FC2EBODMILKHDKAAVSAWAAASPRDMVSDCAWDGMEMHZGDHMNSHKDKSBJMARAAUKGSSNINGODSQTEWANZJUL

2021-12-02
238 min

[STSK-005]Going Undercover To A Physical J* Uniform Reflexology Salon An All Peeping Expose Of The Truth Behind Their Secret Optional Services *4 Girls On Film*

  • censoredcreampieuniformSTSKshirouto 39STSK-005STSK005h-1605stsk00005
    • 2021-10-15
    193 min

    [MIAA-515]"Do You Want Me To Make You Even More Sticky With My Slobbering？" A Slobbering School Uniform Reflexology Salon Filled With Drooling Orgasmic Pleasure! And With Extra Secret Options (Like Sex) You Can Enjoy Penis-Pounding Kisses And

  • white peach censoredcreampieuniformMIAAmoodyzgoemonminna no kikatanMIAA-515MIAA515miaa00515
    • 2021-08-13
    118 min

    [SSIS-155]And Right Next To Me, My Stepmom Was Being Treated Too ... A Big Tits Sch**lgirl Was Getting Continuously Treated With Titty Sensuality-Awakening Skills That She Enjoyed So Much, She Couldn"t Even Squeal With Pleasure Aqua Yamazaki

  • mizuyama yamazaki censoredbig titsuniformSSISs1 no 1 styleoosaki hirokoujiSSIS-155SSIS155ssis00155
    • 2021-07-02
    131 min

    [SSIS-105]A Manipulative Teacher And A Girl In Uniform Who Is Compliant And Can't Say No

  • miharu hanasaki censoredbig titsbeautiful girlSSISs1 no 1 stylemishima rokusaburoSSIS-105SSIS105ssis00105
    • 2021-05-20
    109 min

    [KIR-034]A Married Woman Massage Master Aya Shiomi

  • aya shiomi censoreduniformsingle workKIRstar paradisekirei star paradiseKIR-034KIR034h-254kir00034
    • 2021-05-11
    125 min

    [MSFH-058]Unlimited Ejaculation Sex Club Where Smart Looking Girls Will Guide You To The Ultimate Orgasm With Their Naughty Teasing And Tongue SK**ls Konomi Yoshinaga

  • konomi yoshinaga censoreduniformblowjobMSFHsod createk westms sodMSFH-058MSFH0581msfh00058
    • 2021-05-01
    147 min

    [ADN-313]Beautiful Y********l Gets Massaged By A Perverted Chiropractor Kanon Amane

  • natural kanon censoreduniformbeautiful girlADNattackersjo styleotona no dramaADN-313ADN313adn00313
    • 2021-04-17
    163 min

    [CAWD-209]I'm No Longer Frigid - I've Got No Sexual Confidence, And I Want To Get More Sensitive... She Wanted To Lose Her Innocence And Learn To Feel More Pleasure, So She Decided To Do A Porno Yuyu Haruhi

  • sunny day yui censoreduniformbeautiful girlCAWDkawaiikannana dainanaCAWD-209CAWD209cawd00209
    • 2021-03-13
    172 min

    [IPX-624]Innocent Beautiful Y********l In Uniform Seduced By Her Masseur Through An Erotic Oil Massage... Her Ecstatic, Orgasmic Shivers Don't Stop... Ema Futaba

  • futaba emma censoreduniformbeautiful girlIPXidea pocketgoemondishIPX-624IPX624ipx00624
    • 2021-03-06
    129 min

    [BF-626]A Perverted Oil Massage Therapist With A Beautiful Y********l In Uniform - Toai Nanami

  • toai nanami censoredbeautiful girlsingle workBFbefreeBF-626BF626bf00626
    • 2021-03-02
    135 min

    [SDAB-168]This Naughty And Boyish Girl With A Sensual Body Is Twitching And Throbbing And Cumming Like A Cunt And Moaning And Wailing In Ecstasy Like A Wretched Bitch She's Wearing Her Uniform While Engaging In Oiled-Up Massage Sex Nana Hayami

  • don t be quick censoreduniformschoolgirlSDABsodkomatsu 17youthSDAB-168SDAB1681sdab00168
    • 2021-01-05
    129 min

    [SDAB-161]I Got A Sprain During Club Activities And Went To This Perverted Chiropractor Who Drilled My Pussy... Asuka Momose

  • momose asuka censoredcreampiebeautiful girlSDABsod createryo inugamione s youthSDAB-161SDAB1611sdab00161
    • 2020-11-13
    146 min

    [IPX-562]Beautiful Y********l In Uniform And Her Naughty Masseur - SK**led Fingers And An Erotic Oil Massage Makes Her Lose Her Mind To Pleasure Hikari Azusa

  • azusa hikari censoredbig titsbeautiful girlIPXidea pocketamazing meatdishIPX-562IPX562ipx00562
    • 2020-11-06
    121 min

    [ONEZ-260]Incredible Service - Beautiful Y********l In Uniform Offers A Secret List Of Erotic Reflexology Options To Her Best Customers Urara Kanon vol. 001

  • hanaoto urara censoredcreampiebeautiful girlONEZprestigetodoonezONEZ-260ONEZ260118onez00260
    • 2020-09-04
    44 min

    [ETQR-153](Daydream POV Sex) At This Reflexology Salon, You'll Be Serviced By A Little Stepsister Who Loves Her Big Stepbrother So Much, You'll Get To Fuck Her Brains Out Ichika Matsumoto

  • ichika matsumoto censoredcreampieuniformETQRerotic timeETQR-153ETQR153h-1186etqr00153
    • 2020-09-04
    53 min

    [ETQR-155](Daydream POV Sex) At This Reflexology Salon, You'll Be Serviced By A Little Stepsister Who Loves Her Big Stepbrother So Much, You'll Get To Fuck Her Brains Out Shuri Atomi

  • atomi shuri censoredcreampieuniformETQRerotic timeETQR-155ETQR155h-1186etqr00155
    • 2020-09-04
    42 min

    [ETQR-154](Daydream POV Sex) At This Reflexology Salon, You'll Be Serviced By A Little Stepsister Who Loves Her Big Stepbrother So Much, You'll Get To Fuck Her Brains Out Himari Hanazawa

  • himari kinoshita censoredcreampieuniformETQRerotic timeETQR-154ETQR154h-1186etqr00154
    • 2020-09-04
    60 min

    [ETQR-156](Daydream POV) Raw Creampie OK Sailor Uniform Beauty Massage Parlor Urara Kanon

  • hanaoto urara censoredcreampieuniformETQRerotic timeETQR-156ETQR156h-1186etqr00156
    • 2020-08-28
    240 min

    [GIGL-618]I'm Cumming!! This Massage Lady Hasn't Been Getting Any In A While Hey There, You Want A Taste Of This Rock Hard Cock, Don't You, Don't You!？ 4 12 Ladies

  • censoreduniformamateurGIGLgigolo gigologigoloGIGL-618GIGL618h-860gigl00618
    • 2020-03-21
    136 min

    [DASD-649]Lonely Whorehouse, Uniform Sexual Massage

  • scooping kanon ichikawa censoredbeautiful girldramaDASDdasrokusaburo mishimaDASD-649DASD649dasd00649
    • 2020-03-06
    120 min

    [ONEZ-229]We Promise You 10 Ejaculations! Instant Dick-Sucking And Quickie Sex, Guaranteed! A Beautiful Y********l In A Uniform Made Of See-Thru Fabric! A Slick And Slippery Oil Sex Club Experience Remu Hayami vol. 001

  • remi hayami censoredcreampieuniformONEZprestigetodoonezONEZ-229ONEZ229118onez00229
    • 2020-02-28
    239 min

    [OKAX-596]Fucking Forbidden! Testing The Options At A Secret Sexual Massage In The City! CCD Peeping 240 Min

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-596OKAX59684okax00596
    • 2020-01-31
    61 min

    [ETQR-119]A Beautiful Girl In A Sailor Uniform Is Ready For Her Creampie - Mio Fukada

  • mio fukada censoredcreampieuniformETQRerotic timeno directorETQR-119ETQR119h-1186etqr00119
    • 2019-12-29
    61 min

    [ETQR-115]Creampie Raw Footage A Beautiful Girl Sailor Uniform Reflexology Massage With Creampie Sex Allowed Ruka Aise

  • ruka aise censoredcreampieuniformETQRerotic timeETQR-115ETQR115h-1186etqr00115
    • 2019-12-26
    129 min

    [GS-305]An Alluring Elder Sister Type From The Neighborhood Is Working At A School Uniform Massage Parlor And Rubbing Her Slick And Slippery Panties Against My Crotch And Getting It Rock Hard! I Went To A Sensual Massage Parlor And Out Came This Girl

  • censoreduniformGSsosoru x garconspada ikebukuroGS-305GS3051gs00305
    • 2019-11-29
    60 min

    [ETQR-108]Reflexology By A Beautiful Girl In Sailor Uniform Who Is OK With Creampies Nazuna Nonohara

  • nazuno nonohara censoredcreampieuniformETQRerotic timeETQR-108ETQR108h-1186etqr00108
    • 2019-10-24
    62 min

    [ETQR-105]Sailor Uniform Beautiful Girl Sexual Massage Allows Raw Creampies Rio Ishihara

  • ishihara censoredcreampieuniformETQRerotic timeETQR-105ETQR105h-1186etqr00105
    • 2019-10-11
    217 min

    [GNAB-001]We Got A Hold Of These Babes During An Amateur Boys And Girls Survey!! A Beautiful Young Girl In Uniform x A Business Man With Erectile Dysfunction 8 J*s Will Relieve These Business Man Dicks, Impotent From The Stress Of Their Daily Work, W

  • censoredcreampieschoolgirlGNABprestigebang prestigeGNAB-001GNAB001118gnab00001
    • 2019-10-10
    159 min

    [IENF-034]A Massage Parlor Where The Girls Constantly Flash Their Nipples

  • mihara honoka misuzu kawana censoreduniformIENFienergykikurinie nergyIENF-034IENF0341ienf00034
    • 2019-10-06
    160 min

    [MIDE-690]First Love: Literary Girl Sakura Miura Falls In Love And Lust With A Terrific Tech Massage Therapist Who Makes Her Cum

  • minamata sakura censoredbig titsbeautiful girlMIDEmoody shiroharu osakimoodyz divaMIDE-690MIDE690mide00690
    • 2019-09-29
    56 min

    [ETQR-103]Beautiful Girl In A Sailor Uniform Allows Creampies Reflexology MAKI

  • maki censoredcreampieblowjobETQRerotic timeETQR-103ETQR103h-1186etqr00103
    • 2019-09-27
    240 min

    [GIGL-564]I'm Cumming!! This Old Massage Therapist Lady Hasn't Had Sex In A Long While Here You Go, You Want This Rock Hard Cock, Don't You？ 12 Ladies

  • censoreduniformamateurGIGLgigolo gigologigoloGIGL-564GIGL564h-860gigl00564
    • 2019-09-13
    236 min

    [RIX-069]Private Room Schoolgirl Sexual Massage Peeping 3

  • censoredamateurbeautiful girlRIXprestigerelaxation roomRIX-069RIX069118rix00069
    • 2019-08-31
    237 min

    [CLUB-577]The Total Domain Of Girls In Uniform And Knee-High Socks They Giving Me A Dirty Talk Footjob And Forced Me To Cum Over And Over Again.

  • censoredCLUBhentai shinshi clubCLUB-577CLUB577club00577
    • 2019-08-23
    146 min

    [MDTM-557]A Beautiful Girl Who's Out Of This World Gets Her Whole Body Thoroughly Licked While Wearing Her Uniform vol. 001

  • mana rio miku chibana censoredcreampieblowjobMDTMmedia stationtodouchu kikakuMDTM-557MDTM55761mdtm00557
    • 2019-08-22
    125 min

    [GS-280]A Female Student Goes To The School Infirmary When She Doesn't Feel Well And Gets Treated To An Oil Massage In Cotton Panties - To Increase The Flow Of Blood In Her Body, The School Nurse Massages Her From Her Feet Upwards, Gradually Work

  • censoredschoolgirlGSsosoru x garconspada ikebukuroGS-280GS2801gs00280
    • 2019-08-12
    209 min

    [FSKI-010]"I Can't Say No..." They Thought They Were Safe With A Female Masseuse At A Massage Parlor, But She's Suddenly Switched To A Male Masseur？! Beautiful Young Girls In Uniform Are Sweet-Talked Into Letting The Man Give Them An

  • censoredsquirtingschoolgirlFSKIfirst starultimate planFSKI-010FSKI010h-491fski00010
    • 2019-08-03
    156 min

    [SSNI-534]A Young Girl In Uniform Who Can't Say No, And A Pervy Massage Therapist - Shion Yumi

  • evening beauty censoredbig titssingle workSSNIs1 no 1 stylerokusaburo mishimaSSNI-534SSNI534ssni00534
    • 2019-07-05
    245 min

    [DNW-040]After She Puts On Her Uniform 9

  • censoredcreampiebig titsDNWprestigedocument nowDNW-040DNW040118dnw00040
    • 2019-05-29
    60 min

    [ETQR-084]Sailor Uniform Beautiful Girl Sexual Massage, Raw Creampie Allowed Ameri Hoshi

  • star ameri censoredcreampieblowjobETQRerotic timeETQR-084ETQR084h-1186etqr00084
    • 2019-05-23
    159 min

    [IENF-007]Continuous Nipple Play In A Men's Massage Parlor 3

  • misuzu kawana ayumi reika censoreduniformIENFienergykikurinienfIENF-007IENF0071ienf00007
    • 2019-05-03
    120 min

    [ONEZ-188]Plumlp Big Tits Uniform Mama Sexual Massage Vol. 001 Chie Aragaki

  • tomoe aragaki censoredcreampiebig titsONEZprestigetodoonezONEZ-188ONEZ188118onez00188
    • 2019-04-27
    195 min

    [CLUB-557]An Immoral Doctor Who Targets Girls In Uniform Is Giving Nipple Tweaking Medical Examinations 4

  • censoredbig titsCLUBhentai shinshi clubCLUB-557CLUB557club00557
    • 2019-04-13
    196 min

    [OYC-248]I Called For A Mobile Masseuse At A Hot Spring Inn While On A Business Trip And I Could See Her Underwear Under Her White Uniform! I Couldn't Control Myself And I Poked Her With My Rock Hard Dick. She Just Moaned Quietly And Weakly Said

  • censoredcreampieuniformOYCoyashoku.companymatildahhh groupOYC-248OYC248oyc00248
    • 2019-02-27
    68 min

    [ETQR-078]Creampie Raw Footage Allowed At This Sailor Uniform Beautiful Girl Reflexology Massage Parlor Yui Tomita

  • yu tomita censoredcreampiebeautiful girlETQRerotic timeETQR-078ETQR078h-1186etqr00078
    • 2019-02-22
    240 min

    [OKAX-477]A Must-See For Panty Shot Enthusiasts! A Massage Parlor Where The Girls Unintentionally Provoke You With Panty Shots. 4 Hours

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-477OKAX47784okax00477
    • 2019-01-25
    119 min

    [MDTM-472]Cute Girl's After School Massage Job Vol. 019, Ami Ayuha

  • ayuha ami censoredcreampieuniformMDTMmedia stationuchu kikakuMDTM-472MDTM47261mdtm00472
    • 2018-11-26
    72 min

    [ETQR-065]A Creampie Raw Footage Allowing Beautiful Girl In A Sailor Uniform Aoi Kururugi

  • aoi kururugi censoredcreampieuniformETQRerotic timeETQR-065ETQR065h-1186etqr00065
    • 2018-11-09
    193 min

    [RIX-062]Masturbation Club Peeping "No Stripping" And "No Fucking" Allowed At This Masturbation Club, But We're Negotiating For A Fuck Anyway!! 2

  • censoredbeautiful girlRIXprestigerelaxation roomRIX-062RIX062118rix00062
    • 2018-09-27
    220 min

    [MEKI-003]"She Can't Possibly Say No..." She Came To This Massage Parlor To Elevate Her Womanhood, And Quickly Got Seduced By The Male Therapist Into Giving Her Body Over To Sexual Pleasures This Is What Happens When A Beautiful Young Gir

  • censoredbig titsschoolgirlMEKImercuryMEKI-003MEKI003h-1133meki00003
    • 2018-05-25
    73 min

    [ETQR-041]A Beautiful Girl Sailor Uniform Reflexology Salon Where You Can Get Creampie Sex Shuri Atomi

  • atomi shuri censoredcreampieblowjobETQRerotic timeETQR-041ETQR041h-1186etqr00041
    • 2018-05-25
    119 min

    [MDTM-363]All New An After School Beautiful Girl Rejuvenating Reflexology Spa + Vol.012 Aya Sazanami

  • censoredcreampieblowjobMDTMk m producetodoMDTM-363MDTM36361mdtm00363
    • 2018-03-23
    215 min

    [RIX-055]Company Benefits Peeping On A Business Trip Massage

  • censoredcreampieuniformRIXprestigerelaxation roomRIX-055RIX055118rix00055
    • 2018-03-02
    119 min

    [ONEZ-127]The Highest Class Oriental Married Woman Raw And Rejuvenating Massage Vol.002 Maya Kawamura

  • kawamura maya censoredcreampieuniformONEZprestigetodoonezONEZ-127ONEZ127118onez00127
    • 2017-12-22
    72 min

    [ETQR-018]Creampie Raw Footage OK Sailor Uniform Beautiful Girl Reflexology -Ai Hoshina

  • censoredcreampieschoolgirlETQRerotic timeETQR-018ETQR018h-1186etqr00018
    • 2017-11-24
    118 min

    [MDTM-298]All New After School Beautiful Girl Rejuvenating Reflexology + Vol.006 Seiran Igarashi

  • seirang igarashi censoredcreampieuniformMDTMk m producetodoMDTM-298MDTM29861mdtm00298



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored