mature woma jav censored high visio infidelity




FC2EBODABWLULUHDKAJUFEFSDSSCESDADNWAAAMILKMARASSNIMIDVKSBJPREDGVHATIDNACRROYDAVSA

2020-10-23
204 min

[CHN-192]Renting New Beautiful Women. 100 Suzu Matsuoka (AV Actress) 25 Years Old.

  • matsuoka tin censoredanalslutCHNprestigeturkmenistan samejimataiCHN-192CHN192118chn00192
    • 2020-11-03
    45 min

    [TOTTE-009]Honami

  • censoredcreampiesquirtingTOTTEsadistic villagemagic mirror hardboiledTOTTE-009TOTTE0091totte00009
    • 2020-11-06
    477 min

    [OFJE-274]A Skinny And Sensual Woman Gets Immobilized, Mounted And Pumped With 97 Cum Shots Of Flesh Fantasy Sex So Intense Her Womb Creaks Under The Pressure

  • tsukasa aoi yura kanno censoredOFJEs1 no 1 styleOFJE-274OFJE274ofje00274
    • 2020-11-12
    80 min

    435MFC-054 Nako

  • amateur censoredcreampieamateurmfcmfc-054mfc054435mfc-054
    • 2020-12-05
    145 min

    [NKKD-186]I Lost My Job And My Sister-In-Law Fucked Me To Cheer Me Up. Ayaka Makimura

  • ayaka makimura censoredbig titsmature womanNKKDjet eizomanji groupNKKD-186NKKD186nkkd00186
    • 2020-12-14
    76 min

    259LUXU-1357 Luxury TV 1339 A beautiful secretary with a strangely sexy mole on her mouth is here for the first time! The warmth and stimulation of men who are not satisfied in everyday life. In order to regain the pleasure and pleasure as a woman wh

  • amateur censoredamateurmature womanluxuluxu-1357luxu1357259luxu-1357
    • 2020-12-15
    245 min

    [NPS-406]Real Pickup! Will You Punch My V-Card, Please？ They Forget The Camera's Running At The Chance For Creampie Sex With A Hot Male Virgin - 81 Orgasms! 15 Loads!

  • censoredcreampiesquirtingNPSpetersken kikuchinampaNPS-406NPS406h-021nps00406
    • 2020-12-21
    59 min

    328HMDN-322 [College student x finest god milk celebrity wife] Personal shooting 32 years old God BODY beautiful wife whose husband is sexually weak and frustrated and violently fucked vagina and breast with big cock [Amateur / beautiful wife]

  • amateur censoredcreampiebig titshmdnhmdn-322hmdn322328hmdn-322
    • 2021-01-09
    154 min

    [IPX-595]The Tables Are Turned! I Ordered An Instant-Dick-Sucking Delivery Health Call Girl, And My Evil Lady Boss Showed Up. I'm Sentencing This Bitch To Sex Court! And Now I'm Unleashing Stress-Relieving Piston-Pounding Thrusts Of Justice!

  • anna kami censoredsingle workIPXidea pocketkyoseidishIPX-595IPX595ipx00595
    • 2021-01-15
    73 min

    FC2PPV 1641176 ＃ 50 Hinata Boyish and big breasts. Soft and trained energetic girl and messy creampie sex [Personal shooting] [Gonzo] [High quality]

  • amateur uncensoredfc2
    • 2021-01-22
    118 min

    [HZGD-175]I Started To Lust For My Colleague's Wife, And When I Could No Longer Resist, And Grabbed Her Tight, She Lusted For Me Too And Placed Me Under Confinement And Fucked My Brains Out As She Pleased ... . Yuria Satomi

  • satomi yuria censoredcreampiebig titsHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-175HZGD175h-1100hzgd00175
    • 2021-01-24
    55 min

    285ENDX-322 A 20-year-old female college student who runs out of vaginal cum shot twice! I’m 100 times wetter than usual at the woman on top posture that I can insert from myself!

  • amateur censoredcreampieamateurendxendx-322endx322285endx-322
    • 2021-01-27
    122 min

    496SKIV-002 Yuki who loves cum 2

  • amateur censoredamateurskivskiv-002skiv002496skiv-002
    • 2021-02-09
    87 min

    300NTK-516 173cm tall beauty explosion I milk OL! !! Punch line squeezing with a snake tongue blowjob in front of juniors! !! Suppoli erection Ji ○ port with too big beautiful breasts 360 ° all around milk wall fucking is a masterpiece! !! A greedy b

  • cmiol censoredcreampieamateurntkntk-516ntk516300ntk-516
    • 2021-02-12
    148 min

    [ABW-055]Ameri Saito's Supreme Cherry Popping Fuck Fest 2nd 39 No.2 In The Guaranteed-To-Make-You-Cum-Cherry-Pop Series!

  • amiri saito censoredbig titscosplayABWprestigepunonpen ryouabsolutely wonderfulABW-055ABW055118abw00055
    • 2021-02-16
    132 min

    [KMHRS-039]Product Name: Colorless, Transparent Natural Juices From Unspecified Girl - Contents: Sweat, Pussy Juices, Spit, Cum, Piss - Misuzu Miyamori

  • misuzu miyamori censoredsquirtingamateurKMHRSsod creatememe akiyamakimihoreKMHRS-039KMHRS0391kmhrs00039
    • 2021-02-18
    172 min

    [SSNI-989]During Her Business Trip, To Her Surprise, She Was Booked Into The Same Hotel Room With Her Asshole Boss (Whom She Hates With A Passion) ... So He Banged Her With Excessive Lust And Relentless Piston-Pounding Thrusts And Kept This Big Tits

  • yua mikami censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-989SSNI989ssni00989
    • 2021-02-24
    81 min

    FC2PPV 1699907 [Personal shooting / set sale] The full version of the wife who will be the victim of her husband’s winter bonus being cut significantly

  • amateur uncensoredfc2
    • 2021-03-06
    158 min

    [SSIS-009]Deep Throat Training So Intense She's Bubbling With Drool And Teased To Within An Inch Of Her Life With Deep Pussy G-Spot Development That Fucks With Her Mind So Badly She Descends Into Squishy And Sloppy Orgasmic Sex Tsubasa Sannomiya

  • sannomiya tsubaki censoredbeautiful girlsingle workSSISs1 no 1 styleinaballSSIS-009SSIS009ssis00009
    • 2021-03-12
    90 min

    [DPL-009]RV Sex Aori Arihoshi 22 Years Old

  • aori arisei censoredDPLplay entertainmentDPL-009DPL009h-1557dpl00009
    • 2021-03-17
    79 min

    469G-640 Imadoki Girls’ Circle Exchange (Daddy Activity) Circumstances! Hinata

  • amateur censoredcreampieuniformgg-640g640469g-640
    • 2021-03-20
    60 min

    10musume 032021_01 Amateur girl addicted to kinky sex with middle-aged man Kazumi Okada

  • amateur uncensored10musume
    • 2021-03-27
    50 min

    491TKWA-164 A Good Growing Minato Ward Chubby Lady J ○ And Creampie With Raw Enlightenment!

  • amateur censoredcreampieuniformtkwatkwa-164tkwa164491tkwa-164
    • 2021-03-27
    71 min

    491TKWA-061 Closed Rattle … Daughter Oka ○ Yui ○ Love Love Date With A Female College Student Who Resembles It! I was danced by a ugly man and became a captive of ugly dick!

  • amateur censoredamateurtkwatkwa-061tkwa061491tkwa-061
    • 2021-04-14
    232 min

    [HUNTA-995]"Will You Go All The Way With Me When I Turn 20？" My Hot Stepmom Was On My Dick At Midnight The Day Of My Birthday - Passions They Couldn't Resist Anymore!

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-995HUNTA995hunta00995
    • 2021-04-14
    121 min

    [SSIS-045]His Daughter's Friend Loves Him - And Their Grandad, And Brothers - A Family Of Four Men All With Excellent Sex Genetics Ready To Breed Her Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsingle workSSISs1 no 1 styleamazing meatSSIS-045SSIS045ssis00045
    • 2021-04-21
    75 min

    492JCHA-007 No dislike with the old man

  • amateur censoredamateurbeautiful girljchajcha-007jcha007492jcha-007
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-04
    55 min

    498DDH-013 [Men’s Esthetic Voyeur] If you get an erection involuntarily on the H cup pie that the big tits practitioner hit on purpose …

  • amateur censoredcreampiebig titsddhddh-013ddh013498ddh-013
    • 2021-05-14
    79 min

    FC2PPV 1817900 [3480 → Limited number 2480] [First shot ㊙️ Video] Only seen as an adult J’s K ❤️ Nurse dreaming 18 years old ❤️ Enjoy the immature body of one experienced person ❤️ Tell me a safe day and insert raw Massive vaginal cum shot ❤️

  • amateur uncensoredfc2
    • 2021-06-05
    117 min

    [LOL-195]Mouth Specialist... "Stepbrother, Forgive Me..." Marina Keeps Getting Fucked By Her Stepbrother! With Marina Saito

  • marina saito censoredcreampiebeautiful girlLOLglay zloli senkaLOL-195LOL19512lol00195
    • 2021-06-11
    65 min

    FC2PPV 1862948 [Leaked] Big breasts II cup gravure idol individual photo session Hotel video leaked From idol Gonzo with secret individual shooting Creampie [Top secret data attached with set purchase]

  • amateur uncensoredfc2
    • 2021-06-18
    57 min

    Caribbeancom 061821-001 Special Lesson After School: Please Play With Remote Control Rotor Anri Kizuki

  • anri kizuki uncensoredcreampiecaribbeancom
    • 2021-06-19
    220 min

    [REXD-366]The Girl Who Used To Bully Me... The Defeated Older Woman "Do You Remember Me？"

  • censoredcreampiebig titsREXDredgroupREXD-366REXD366rexd00366
    • 2021-06-25
    146 min

    [MIFD-164]Young Wife Debut! - I Want Pleasure That Can't Be Bought - Mitsuki Tominaga

  • miina tominaga censoredslutsingle workMIFDmoodyzk westmoodyz freshMIFD-164MIFD164mifd00164
    • 2021-06-30
    52 min

    SIRO-4565 [First shot] [Beautiful white limbs] [Shaved OL] A local office lady who longs for Tokyo shoots AV for Tokyo funding. She with her beautiful limbs sticks out her nice ass and gets wet with the pleasure of her cock. AV application on the net

  • amateur censoredamateursirosiro-4565siro4565siro-4565
    • 2021-07-08
    48 min

    FC2PPV 1911064 [Rare item] Beautiful athlete outflow ③ Face and milk are amazing

  • amateur uncensoredfc2
    • 2021-07-10
    156 min

    [MKMP-406]I was Continually and Single-Mindedly Fucked by Akari Nimura with my Back to the Setting Sun Melting into the Sky

  • akari shinmura censoredcreampieslutMKMPk m producesamoarimillionMKMP-406MKMP406mkmp00406
    • 2021-07-13
    60 min

    H4610 ki210713 Nanako Shirai 20years old

  • amateur uncensoredh4610
    • 2021-07-13
    140 min

    [STARS-416]Flexible Ballerina Fucked With Huge Dick - 3 films. Anna [High-quality 4K images!]

  • anna censoredbeautiful girlsingle workSTARSsod createsuisei akaisod starSTARS-416STARS4161stars00416
    • 2021-07-14
    152 min

    [SSIS-119]*Completely Uned! POV! No Makeup! Anything Goes! Yura Kano's Raw Carnal Instincts Bared For Real Sex! Genuine Couple's Hot Spring Trip Leads To Wild, Rare, 200 Erotic Fuck Footage

  • yura kanno censoredbeautiful girlsingle workSSISs1 no 1 stylemichiru arashiyamaSSIS-119SSIS119ssis00119
    • 2021-07-22
    74 min

    FC2PPV 1935465 [Complete Amateur 114] Jd Ako 20 Years Old, Loss Of Genuine Virginity, Premium 4k

  • amateur uncensoredfc2
    • 2021-07-24
    240 min

    [ITSR-094](#This Is How You Seduce An Underwear Sales Girl!!) Masters Of Seduction 4 Hours 12 Ladies These Lovely Ladies Are Handing Over Their Freshly Undressed Underwear And Getting Fucked In The Raw, For Your Viewing Pleasure.

  • censoredamateurITSRbig mocalmaxtop itadakiITSR-094ITSR09457itsr00094
    • 2021-08-12
    58 min

    FCP-034 [Delivery Only] Instead Of Angry Waves, Double Facial Cumshots! !! The Limit To Squeeze Until Empty!

  • amateur censoredamateurslutfcpfcp-034fcp034fcp-034
    • 2021-08-13
    154 min

    [PPPD-949]I Want To Be Outgoing: The AV Debut Of An Outgoing Female Anime Nerd With Big Tits! Ryo Arima

  • arima rin censoredbig titssingle workPPPDoppaiPPPD-949PPPD949pppd00949
    • 2021-08-14
    94 min

    [VENX-067]While My Dad Was Away On A Company Vacation, I Spent The Entire Time Fucking My Stepmom, Whom I Had Always Adored, As We Spent Some Time Together In A Creampie Kind-Of Life Narumi Kawabata

  • narumi kawabata censoredcreampiemature womanVENXvenuskitano majimeincest vi nasuVENX-067VENX067venx00067
    • 2021-09-03
    119 min

    [MIDE-968]I Was Betrayed By My Boss And Had Sex With The Business Partners Mizuki Aiga

  • mizuki ai censoredcreampiesquirtingMIDEmoodyzkindaichishougo roumoodyz divaMIDE-968MIDE968mide00968
    • 2021-10-09
    126 min

    [NSFS-032]A Marital Hostage Incident. A Wife Is Used As A Fuck Toy From Morning To Night. Haruka Nogi

  • haruka nogi censoredmature womansingle workNSFSnagae styletomitake taroNSFS-032NSFS032nsfs00032
    • 2021-11-05
    191 min

    [UMD-803](Some Sad News) After This, These Big Tits Babes Are Going To Be Feasted On By These Old Massage Therapists!!

  • inaba yoshine yuria censoredbig titsUMDleotabu oosakiUMD-803UMD803125umd00803
    • 2021-11-13
    41 min

    FC2PPV 2429651 Super Cute 19 Years Old Working At A Karaoke Shop! !! Slender Busty Idol Face, "What’s Your Specialty？ No Hand" "I Was Naked In The Car In The Daytime And Ejaculated In The Mouth, Then Blocked And Stunned …

  • amateur uncensoredfc2
    • 2021-11-16
    60 min

    [HEYZO-2657]Jessica Takizawa Orgasms With A Horny Pussy Girl Vol.23

  • amateur uncensoredcreampieheyzo
    • 2021-11-26
    85 min

    529STCV-038 [The Strongest Milk Pressure J Cup In Adachi-Ku] Three Basketballs! ？？ Nail Your Eyes And Get In The Way Of Sex At The House Of A Female College Student With Huge Breasts! Superb Pleasure 2 Ejaculation While Being Wrapped In A Marshmallow

  • amateur censoredbig titsamateurstcvstcv-038stcv038529stcv-038
    • 2021-12-03
    153 min

    [MIDV-011]Your First Sleepover Date You"ll Hold Hands, Kiss, Laugh, And Then, You"ll Forget All About The Time As You Intertwine Your Bodies In Deep And Rich Sex Mio Ishikawa

  • ishikawa mio censoredblowjobbeautiful girlMIDVmoodyzusapyonmoodyz divaMIDV-011MIDV011midv00011
    • 2021-12-03
    80 min

    393OTIM-097 [Delusional Subjectivity] Sexual Intercourse With A Beautiful Girl With Big Tits Rina Takase

  • amateur censoredcreampiebig titsotimotim-097otim097393otim-097
    • 2021-12-10
    24 min

    FC2PPV 2504844 Immediate Scale 3 People Continuously Mass Fired In The Car Dedicated To Blowjob In The Middle Of The Day. Finally Live In The Car, It Feels Too Comfortable And A Large Amount Of Vaginal Cum Shot ☆ Mizuki-Chan, A Beautician Who Likes B

  • amateur uncensoredfc2
    • 2021-12-29
    72 min

    FC2PPV 2550637 She’s Crazy While Saying "I Feel Guilty …" !! She Refused To Take A Gonzo At First, But At The End She Got A Vaginal Cum Shot And Lost Communication …

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored