mature woman big tits jav butt housewife




FC2AMBINATRHODVJULSPRDKBIMIDVAWDFSDSSSTARSCESDADNWAAAATIDDASDAPODPREDMIAAAVSARBD

2020-09-06
135 min

[SORA-266]A Showoff Exhibitionist Journal Yuri Ohara

  • ohara yuria censoredcreampieslutSORAyama to sorahimu lockSORA-266SORA266sora00266
    • 2020-09-27
    110 min

    [KNMB-004]All Raw Style @Maria #Red-Haired Gal #Huge Pale Titties #Sweet Sub #Sexy Santa #Half-In Half-Out #Huge Creampie

  • censoredcreampiecosplayKNMBfirst star100 raw styleKNMB-004KNMB004h-491knmb00004
    • 2020-10-01
    66 min

    200GANA-2336 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 175 If you press a kiss in a punishment game, it will be swept away as it is ♪ Bed in as it is exposed ♪ The erotic body of fair-skinned big tits is caug

  • amateur censoredbig titsamateurganagana-2336gana2336200gana-2336
    • 2020-11-10
    138 min

    [KIRE-011]"I Noticed You Doing It, But You Know, I Don't Mind Being Creampied (LOL)" Creampie Unleashed - Momoka Tachibana

  • moeka tachibana censoredcreampiesingle workKIREsod createmiura leftbeauty kirei sodKIRE-011KIRE0111kire00011
    • 2020-11-13
    125 min

    [DVAJ-483]My Sexual Relations With My Stepson Have Gone On For 3 Years, My Husband Is Being Suspicious. Even If I Try To Break Off The Relationship Now, My Teenage Stepson Won't Listen To Me, And Still Comes To Get My Body When My Husband Isn

  • kawakami nanami censoredmomsingle workDVAJalice japanhiromichi hoseDVAJ-483DVAJ483dvaj00483
    • 2020-11-15
    78 min

    345SIMM-552 Good face, good milk, good personality! J ○ who has a plump body of growth ○ is taken to the hotel from daytime and loves SEX! !! Suck, rub and shake, enjoy the fluffy G cup to your heart’s content ♪ Blessed body plump vaginal cum sh

  • amateur censoredcreampiebig titssimmsimm-552simm552345simm-552
    • 2020-11-23
    118 min

    [XVSR-566]Making Babies With My Sweet Wife - Creampie Sex Hibiki Otsuki

  • otsuki sound censoredcreampiesingle workXVSRmax ak c takedacalenXVSR-566XVSR566xvsr00566
    • 2020-12-05
    240 min

    [HUNTA-902]"Sorry For Making Such A Mess!" Submissive Maid Squirts All Over The Place And Gets The Entire Room Wet As She Keeps Cumming! Then I Make Her Apologize, Clean The Floor And Lick My Feet As I Cum Inside Her Again And Again!

  • censoredsquirtingHUNTAhunterkawajirihhh groupHUNTA-902HUNTA902hunta00902
    • 2020-12-12
    171 min

    [IPX-573]FIRST IMPRESSION 146 Amu Amatsuka

  • amatsuka amu censoredsquirtingbeautiful girlIPXidea pocketkyoseidishIPX-573IPX573ipx00573
    • 2020-12-19
    38 min

    [HHKL-078]"Hey, What Do You Think About This Underwear？ Does It Look Cute On Me？" My Plain Jane Big Stepsister Started Working For An Underwear Company, And As She Began To Start Wearing Sexy Underwear, She Gradually Became More Sexy And Erot

  • nene tanaka censoredcreampiebig titsHHKLhunterkonjac kanohhh groupHHKL-078HHKL078hhkl00078
    • 2020-12-21
    100 min

    [HAHOB-024]We Found A Members Only Lounge By The Harbor Where The Girls Do Non-Nude Erotica! Sari Nagahama

  • censoredbig titsbeautiful girlHAHOBhapiness holicHAHOB-024HAHOB024h-706hahob00024
    • 2020-12-31
    27 min

    S-Cute 731_kanon_08 Soaked SEX that warms the body wet with rain / Kanon

  • kanon censoredamateurkanonkanon-08kanon08731-kanon-08
    • 2021-01-01
    96 min

    [VENU-996]I Can't Live Without My Stepson... Sexy Stepmoms Indulge In the Ultimate Erotic Creampie Fucks - 50 Incredible Orgasms Yu Shinoda

  • shinoda yu censoredcreampiebig titsVENUvenuspeterfakecest winntersVENU-996VENU996venu00996
    • 2021-01-01
    108 min

    [SORA-288]Total Mental Control - Personality Manipulation - Psycho Slut Mistaken For A Nurse - Adultery From Hell Edition Ai Mukai

  • ai mukai censoredsingle worknurseSORAyama to sorayosukeSORA-288SORA288sora00288
    • 2021-01-13
    43 min

    FC2PPV 1642758 [Appearance / Uncensored / Cheating NTR] God Fcup Beauty Witch NTRw who loves each other with super rich SEX with other married women Complete service & seeding cum shot at the woman on top posture! Cowgirl tech w of a beautiful wi

  • amateur uncensoredfc2
    • 2021-01-24
    81 min

    345SIMM-595 Super innocent idol face J ○ rushes into the family-less toilet in search of Ochi ○ Po! Erotic videos are blackmailed (laughs) by a horny slut who loves sex very much, and hotein → camera soaked laser tide is shot! The inside, mouth, and

  • amateur censoredcreampiesquirtingsimmsimm-595simm595345simm-595
    • 2021-01-31
    243 min

    [KSBJ-117]Creampie Sex With 12 Married Women With Beautiful And Supply Bodies vol. 02

  • freedom haruka mirai censoredcreampiebig titsKSBJksb planning emanuelKSBJ-117KSBJ117ksbj00117
    • 2021-02-06
    244 min

    [DVDMS-629]Ordinary Guys & Girls Caught On Camera - College Girl Amateurs Only - Platonic Friends Build Up To 20 mL Of Pent-Up Cum Behind Closed Doors! 6 - Shy College S*****t Amateur Babes Give Their Male Friends Handjobs, Jerk Them Off With Fles

  • censoredcreampiebig titsDVDMSdeep sgreenhouse effectDVDMS-629DVDMS629dvdms00629
    • 2021-02-20
    70 min

    476MLA-024 Seeding is crazy with the 5th Ji ○ port in my life! !! 3 productions of vaginal cum shot in a light gal waiting for pick-up! !!

  • amateur censoredcreampieamateurmlamla-024mla024476mla-024
    • 2021-02-25
    73 min

    FC2PPV 1701084 [No appearance] Unauthorized raw vaginal cum shot to a super rare slender beauty Shrimp warp NTR [Personal shooting] Continuously alive with a generalized erogenous zone and seeding sanctions on a nasty pussy cheating just before marri

  • amateur uncensoredfc2
    • 2021-02-26
    51 min

    380SQB-090 Minami

  • amateur censoredbig titsamateursqbsqb-090sqb090380sqb-090
    • 2021-02-26
    64 min

    [MASE-014]Horny Older Woman 32 Year Old Nozomi Has Her Plump White Body Filled With Cum As She's Fucked Standing From Behind Twice! Nozomi Haneda

  • nozomi haneda censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-014MASE01449mase00014
    • 2021-03-12
    57 min

    [CLO-134]I'm With A GothLoli Barely Legal Babe Who's Cute As A Doll ... Yui Nagase (Not Her Real Name)

  • yui nagase censoredsquirtingcosplayCLOchobitchchovicCLO-134CLO134h-1435clo00134
    • 2021-03-14
    35 min

    S-Cute 823_mana_02 Her morning starts in cowgirl and ends in cowgirl / Mana

  • mana censoredamateurmanamana-02mana02823-mana-02
    • 2021-04-09
    120 min

    [MDTM-716]The Cutest And Smartest S*****t In Class Complete POV Sex With That Girl In A School Uniform You Always Had A Crush On Natsu Tojo

  • natsu tojo censoredcreampieschoolgirlMDTMuchu kikakutodoMDTM-716MDTM716mdtm00716
    • 2021-04-17
    120 min

    [HND-981]Secretly Breeding My Girlfriend's Little Sister Nana Maeno

  • nana maeno censoredcreampieuniformHNDhon nakausa pyonHND-981HND981hnd00981
    • 2021-04-17
    140 min

    [JUL-555]An Ultra Orgasmic And Horny G-Cup Titty Slut Has Cum Down To Bless Us All!! This Married Woman Receptionist Has Joined All Of The Men In The Office Together As Fellow Pussy Posse Members Tachibana-san (Not Her Real Name) 30 Years Old

  • censoredcreampiebig titsJULmadonnaJUL-555JUL555jul00555
    • 2021-04-28
    201 min

    [HHH-231]A Thirty-Something Wife And Her First Experiences Before She Turns 30 She's D***king Down Her First Shots Of Cum She's Getting Her First Taste Of A Big Dick, Bigger Than Her Husband's, For Her Creampie Sex Debut

  • censoredamateurHHHviptriple hHHH-231HHH23178hhh00231
    • 2021-05-07
    159 min

    [MUDR-147]Y********l Is Enthralled With Men's Crotches... Impregnation Party Aoi Nakajo

  • nakagusuku censoredcreampieschoolgirlMUDRmukuMUDR-147MUDR147mudr00147
    • 2021-05-13
    145 min

    [ABW-092]全裸家政婦 新感覚ヴァーチャルセックス性活をあなたに。 Staff01 愛音まりあ 【MGSだけのおまけ映像付き 10分】

  • amateur censoredamateurabwabw-092abw092abw-092
    • 2021-05-27
    105 min

    [SPRD-1416]This Is Much Better Than My Husband's... Honoka Nakayama

  • hoka nakayama censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1416SPRD141618sprd01416
    • 2021-05-28
    120 min

    [MIMK-089]A Book About Getting Nookie From A Babe At A 1000 Yen Barber Shop 2 Live Action Adaptation Original Story By Shinema Hayo The Long-Awaited Second Live Action Adaptation Of This 200 Flesh Fantasy Comic Series That Has Sold A Total Of 110,000

  • censoredcreampiebig titsMIMKmoodyzdragon nishikawamankitsuMIMK-089MIMK089mimk00089
    • 2021-06-03
    62 min

    SIRO-4507 [First shot] [Dirty juice festival] A stimulus that is too strong for a frustrated body. Big sister who has increased sensitivity enough to leak lewd juice from there .. AV application on the net → AV experience shooting 1553

  • amateur censoredbig titssquirtingsirosiro-4507siro4507siro-4507
    • 2021-06-16
    125 min

    [GVH-246]Naughty Nurses Satomi Suzuki

  • satomi suzuki censoredcreampiegrandfatherGVHglory questham the mcGVH-246GVH24613gvh00246
    • 2021-06-18
    44 min

    FC2PPV 1873223 [Individual shooting] Minami 19 years old Innocent and innocent beautiful girl! A plump body that can conceive a body even if it has a Ubu personality! Two consecutive vaginal cum shots with lust for an obedient super beautiful girl!

  • amateur uncensoredfc2
    • 2021-06-26
    55 min

    H4610 ori1759 Ayane Takubo 21years old

  • amateur uncensoredh4610
    • 2021-07-08
    159 min

    [PIYO-120]The Day I Fell For My S*****t's Unsolicited Temptations...Days Living Together With A Big Tits S********l Who Ran Away From Home And Pleads For Creampies. Mei Satsuki

  • satsuki mei censoredcreampiebig titsPIYOhyokopiero daPIYO-120PIYO1201piyo00120
    • 2021-07-14
    121 min

    [TPPN-199]She's Here! The Arrival Of A Gorgeous Goddess With A Sweat-Slick, Perfect Body For Men To Covet! Orgasmic Creampie Vacation Karen Asahina

  • karen asahina censoredcreampiesingle workTPPNteppanTPPN-199TPPN199tppn00199
    • 2021-07-15
    120 min

    [BKD-267]Stepmother and C***d [Sequel Yabunoyu-ji] Tsubaki Kato

  • kato camellia kaoru natsuki censoredmature womansingle workBKDrubykoji tsujitobijiBKD-267BKD267bkd00267
    • 2021-07-16
    42 min

    FC2PPV 1925653 [None] [Limited To 100 Pieces 2980 → Off To 1480pt! ] Former Local Station Reporter! Appearance Prepared To Wear A Mask That Drastically Reduces Work ♥ ️ Appeal For Vaginal Cum Shot From Yourself! ♥ ️ * Review Benefits / High Image Qua

  • amateur uncensoredfc2
    • 2021-08-19
    56 min

    10musume 081921_01 Fuck The Really Nice Shape Of Big Tits Girl Yoko Haneda

  • amateur uncensored10musume
    • 2021-08-26
    146 min

    [IENF-162]You"ll Be Able To Clearly See Everything, Even Down To The Number Of Anal Wrinkles On Her Ass! No Mosaic Censoring A Consecutive Orgasmic Anal Masturbation Show-Off 3

  • momose asuka rumi tadami censoredanalIENFie nergyienfIENF-162IENF1621ienf00162
    • 2021-09-03
    141 min

    [HODV-21607](All POV) Rural Girls With Accents: Shizuoka Dialect Rin Kagura

  • kagura rin censoredcreampiesingle workHODVh m pHODV-21607HODV216075642hodv21607
    • 2021-09-03
    29 min

    FC2PPV 2132750 [Leakage] * Limited Quantity Sale * S-Class Magazine Model Talent August Long Vacation Blow Outflow On A Stealth Trip [Handling Precautions]

  • amateur uncensoredfc2
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-30
    71 min

    533NNS-010 Minimum Beauty Big Tits Creampie Pussy Video Leaked! !! Even Though It Is Small, It Comes Out And The Sensitivity Is Good! !! Barishiko Masturbation Video That Guarantees Continuous Ejaculation During Vaginal Cum Shot! !!

  • amateur censoredcreampiebig titsnnsnns-010nns010533nns-010
    • 2021-10-12
    132 min

    [KTRA-337]Extracurricular Creampie Lesson Of A Beautiful Girl With Small Tits Risa Shiroki

  • risa shiroki censoredcreampieKTRAk tribeKTRA-337KTRA337
    • 2021-10-14
    60 min

    FC2PPV 2342287 Eh？ "Can I Quit After All？" The Whole Story That I Was Able To Miraculously Take A Gonzo With The Former Underground Beautiful Girl Of The Example! I Was Stunned By The Sound Of Man Juice That Echoed From Beginning To End Again

  • amateur uncensoredfc2
    • 2021-10-28
    56 min

    10musume 102821_01 I Was Tired From Lack Of Sleep, So I Got Tired Many Times Hitom Mukai

  • amateur uncensored10musume
    • 2021-10-29
    160 min

    [WAAA-117]Sorry To Keep You! Release of Black World Fuck Megaton Climax of Incontinence and Creampies in Unmatched Big Dick Large Marathon Orgy Kana Yume

  • kana yui censoredcreampiesquirtingWAAAones factorywanzWAAA-117WAAA117waaa00117
    • 2021-11-19
    117 min

    [ROE-021]Maki Tomoda Upgrades To Top 40 Label Monro! A Stepmom On Her Second Marriage. A Stepson Who Can"t Cut The Creampie Apron Strings

  • maki tomoda censoredcreampiebig titsROEmadonnaunicorn fukudamonroeROE-021ROE021roe00021
    • 2021-11-25
    53 min

    1Pondo 112521_001 Hospitality: Women who love the glans Mio Futaba Miku Aoyama Yuka Ohashi Akari Soma

  • amateur uncensored1pondo
    • 2021-11-28
    124 min

    [GODR-1045]The Massage Parlor Girl Saw His Boner Bulging Out From His Paper Underpants, and She Doesn"t Need Any Words!!

  • censoredmarried womanamateurGODRvipgodGODR-1045GODR104578godr01045
    • 2021-12-04
    106 min

    [SQTE-392]Godly Breasts: 102 Centimeters Of Jiggling Fuck - Hana Himesaki

  • himesaki hana censoredbig titsblowjobSQTEs cutes cute s cuteSQTE-392SQTE392sqte00392
    • 2021-12-08
    45 min

    511SDK-018 [Production Ok] Sex With A High-Class Delivery Health Lady And Raw Vaginal Cum Shot. Too Dense Time Drowning In Libido

  • amateur censoredbig titsamateursdksdk-018sdk018511sdk-018
    • 2021-12-09
    164 min

    [MIST-356]Direct Hit On An Unsafe Day!! You Can Make Babies With The Maid From The Temp Agency. Mio Ichijo

  • ichijo mio censoredcosplaybeautiful girlMISTmr michirusaitaMIST-356MIST3561mist00356



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored