mature woman creampie amateur nampa




FC2AUKGRBDHDKAMIDVDASDMARAATIDONEZMILKVENUMIDEAUKSSSNIWAAADTTCHRVSTARSSPRDSQTEKBI

2020-12-31
120 min

[SSNI-952]The Wife Of My Part-Time Job's Boss Is Too Much Of A Pervert For My Body To Handle... Saki Okuda

  • saki okuda censoredsluthandjobSSNIs1 no 1 stylekitorune kawaguchiSSNI-952SSNI952ssni00952
    • 2021-01-01
    242 min

    [NACX-069]Every Time You Thrust, Her Voluptuous Body Will Jiggle And Wiggle! 20 Colossal Tits Mature Woman Babes In Creampie Sex vol. 03

  • yoshikawa aimi yuka takashima censoredcreampiebig titsNACXplanet plusnanakuruNACX-069NACX069h-237nacx00069
    • 2021-01-21
    60 min

    FC2PPV 1652972 [Complete amateur 98] Hitomi 19 years old, complete appearance, vaginal cum shot & mouth shot to a plump fair-skinned beautiful girl

  • amateur uncensoredfc2
    • 2021-01-22
    153 min

    [PXH-019]This Girl Answered Our Ad # 003 # Sa-chan (20 Years Old) # From Miyazaki # Divine I-Cup Titties # She Loves To Be Spanked # A Colossal Tits Freelancer # She Cums When Choked # An Explosively Prematurely Cumming Babe

  • censoredcreampiebig titsPXHprestigeprestige hmjmPXH-019PXH019118pxh00019
    • 2021-01-24
    125 min

    [TWYB-002]The Forbidden Secret Part-time Job Of Local Teachers - Natsuno Ayamine

  • natsuno ayamine censoredcreampiebig titsTWYBtoyohikotoyohikotoyohiko kikakuTWYB-002TWYB002twyb00002
    • 2021-01-30
    80 min

    300NTK-510 Mysterious black gal beauty x sake pond meat forest 4P = erotic festival! !! Everything is unknown! !! The only thing I can understand is … too erotic brown spear man BODY & sexual desire only that overflows! !! It’s the one

  • amateur censoredcreampiesquirtingntkntk-510ntk510300ntk-510
    • 2021-01-30
    149 min

    [MIAA-380]Busty Wife Gets Fucked By Her Husband`s Hated Boss All Over Again Hikari Sena

  • hikari sena censoredcreampiesingle workMIAAmoodyzzaku araieveryone s porn starMIAA-380MIAA380miaa00380
    • 2021-01-30
    152 min

    [MIDE-876]Rough G*******g Sex With A Female Teacher - Rough Deep Throat/Group Shaming - Nana Yagi

  • nana yagi censoredblowjobsingle workMIDEmoodyzbungo maedamoodyz divaMIDE-876MIDE876mide00876
    • 2021-02-04
    88 min

    [REBD-531]Mahiro 2: I'm Home! Mahiro Tadai

  • mahiro yui censoredsingle workREBDrebeccachikara sawamuraREBD-531REBD531h-346rebd00531
    • 2021-02-07
    240 min

    [MLSM-038]Smoking Hot MILF BEST Collection Mio Kimijima 4 Hours, Slender Mature Babe With Big Tits

  • kimishima mio censoredcreampiebig titsMLSMmellow moonMLSM-038MLSM038mlsm00038
    • 2021-02-12
    28 min

    FC2PPV 1682648 Until 18 1480 ＃ busty restaurant part-time job was processed in the morning

  • amateur uncensoredfc2
    • 2021-02-26
    132 min

    [JMTY-045]#SupportFile01 Hinako (Hotel Play 5) Giving A Beautiful Girl In A School Uniform Who Works Part Time After School A Creampie And Making Her D***k Cum

  • censoredcreampieJMTYteacher delusion groupukyo lifeJMTY-045JMTY045jmty00045
    • 2021-02-26
    54 min

    FC2PPV 1691317 [No x bath SEX] Sex in the bathtub … Deep Throating and mass vaginal cum shot !？ (NO.006 Naughty / First half) “Personal shooting / Gonzo”

  • amateur uncensoredfc2
    • 2021-03-11
    120 min

    [FSDSS-186]Multiple Ejaculation Recipocrated Love Sex At The Soapland Staring Into Each Other's Eyes Yume Nikaido

  • nikaido yume censoredbig titsbeautiful girlFSDSSfalenoflagmanfaleno starFSDSS-186FSDSS1861fsdss00186
    • 2021-03-12
    69 min

    [DHT-255]Snagging A Married Woman With A Huge Ass And A Body Shape To Die For! Miu 29 Years Old

  • censoredcreampiemarried womanDHThot entertainmentstudio zeroDHT-255DHT25559dht00255
    • 2021-03-12
    160 min

    [ZMEN-081]My Friend's Girlfriend Slipped Into My Bed During A Sleepover... 6 Unable To Resist The Pheremones From This Lusty Older Woman I Cover Her Mouth With Mine To Stifle The Sound Of Her Cumming As I Fuck Her Over And Over!

  • really aishin shinkawa censoredblowjobZMENz mennaveZMEN-081ZMEN081h-1371zmen00081
    • 2021-03-16
    53 min

    481SACZ-014 Risa 1

  • amateur censoredamateurbdsmsaczsacz-014sacz014481sacz-014
    • 2021-03-22
    100 min

    241GAREA-503 Yuzupon

  • amateur censoredamateurbeautiful girlgareagarea-503garea503241garea-503
    • 2021-04-09
    23 min

    FC2PPV 1761971 [First cock 2 blowjob excitement & squirting view view] << I can not tell my boyfriend → It is really dangerous if I get caught >> Beautiful looks saffle ❤ While handjob, it collapses into pleasure with amazing blowjob tech

  • amateur uncensoredfc2
    • 2021-05-02
    62 min

    SIRO-4472 [First shot] [Late bloomer married woman] [Polite immoral service] A late bloomer married woman who is not satisfied with her sexual life appears. To a beautiful ass married woman who has been delusional without being dealt with by her husb

  • amateur censoredmarried womanamateursirosiro-4472siro4472siro-4472
    • 2021-05-21
    178 min

    [URE-066]Original Work: Fetakishi The Slutty Wives Of The Shopping District We've Loyally Recreated The Impregnating Sex That Transforms Docile Big Titty Wives Into Pliant Sex Animals! Asahi Mizuno

  • mizuno chaoyang censoredbig titsmature womanUREmadonnakitorune kawaguchiure.comiURE-066URE066ure00066
    • 2021-05-28
    144 min

    [CLUB-642]I Have A Fetish For School Swimsuits, So I Like To Secretly Film Girls With Big Tits In School Swimsuits. Creampie Sex Using My Horny Cock, From Start To Finish.

  • censoredcreampiebig titsCLUBhentai shinshi clubCLUB-642CLUB642club00642
    • 2021-06-10
    134 min

    [SPRD-1418]Big Booty Temptation Yuri Tadokoro

  • yuri tadokoro censoredmature womansingle workSPRDtakara eizokon oriharualeddinSPRD-1418SPRD141818sprd01418
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-01
    126 min

    [GAS-486]Unveiling The Face Of A Popular Chubby L-cup Prostitute Princess Misa Sakurai

  • misa sakurai censoredbig titssingle workGAScinema unit gasa tgasGAS-486GAS48671gas00486
    • 2021-07-02
    145 min

    [SSIS-077]* Absolutely No Script!! POV Fuck! No Makeup! It's All Here! The True Dirty Nature Of Minami Kojima Is Revealed In This Exposed Fuck Session!! A Super Rare Film Of This Real Couple's Hot Spring Trip With Nonstop Fucking, Too Raw And

  • minami kojima censoredsquirtingsingle workSSISs1 no 1 styleSSIS-077SSIS077ssis00077
    • 2021-07-10
    241 min

    [NASH-533]Creampie in 12 Beautiful Mature Women Who Give Off the Adult Scent of Pheromone

  • yumi anno aki sasaki censoredcreampiebig titsNASHnadeshikoNASH-533NASH533nash00533
    • 2021-07-10
    51 min

    [bini-290]ゆう 3(22)

  • amateur censoredcreampiebig titsbinibini-290bini290bini-290
    • 2021-07-16
    71 min

    [YMDS-044]An Uhar Bitch A Spanish Bitch With A Glamorous Body EMILY

  • emily hikari sakuraba censoredbig titsblowjobYMDSmomotaro video publishingdukeyoung peachYMDS-044YMDS044ymds00044
    • 2021-07-24
    240 min

    [JKSR-503]Cute And Distracting Ladies Under 153cm! Petite Ladies You Just Want To Fuck-28 people, 4 hours

  • censoredmarried womanamateurJKSRbig mocalobockeypink junkieJKSR-503JKSR50357jksr00503
    • 2021-07-30
    100 min

    [YST-251]Whether She"s a Lady or a Total Slut, I Want to Fuck Miss Hido as much as I Can. Riria Hido.

  • riria hido censoredcreampiesingle workYSTkoyachoYST-251YST251540yst00251
    • 2021-08-05
    53 min

    C0930 ki210805 Sayoko Shintani 49years old

  • amateur uncensoredc0930
    • 2021-08-07
    133 min

    [BADA-020]Breaking In Saya Mibari At The Masochist Club

  • minami saya censoredsingle workbukkakeBADAbarutanusubashi suidiamondBADA-020BADA020bada00020
    • 2021-08-08
    121 min

    [PARM-167]Underskirt Explorers!

  • nagaoka maria okawa censoredPARMaroma kikakumousou chirarizumuPARM-167PARM167parm00167
    • 2021-08-12
    56 min

    10musume 081221_01 An Office Lady With Outstanding Style Wear A Swimsuit Miki Inoue

  • amateur uncensored10musume
    • 2021-08-21
    120 min

    [APNS-254]Group Fuck Cuckold Wife Braids And Uniform..."Until All Of You Are Satisfied, I"ll Do Anything For You In Front Of My Husband So Fuck Me All You Want" Ai Mukai

  • ai mukai censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-254APNS254apns00254
    • 2021-08-30
    68 min

    HHSI-009 Rina (Takase Rina)

  • amateur censoredamateurhhsihhsi-009hhsi009hhsi-009
    • 2021-08-30
    47 min

    292MY-466 Kaneko hitona 2

  • amateur censoredcreampiebig titsmymy-466my466292my-466
    • 2021-09-05
    122 min

    [LOL-200]Young Beautiful Girl Specialty. The Cutest Girl For Overnight POV Creampie Sex. Ten Hasumi

  • hasumiten censoredcreampieschoolgirlLOLglayzrori senkaLOL-200LOL20012lol00200
    • 2021-09-10
    180 min

    [FFFS-031]Taking MILFs Back Home For A Fuck! Married Sluts Ride Other Men"s Dicks - Caught On Hidden Camera 28 - Horny Working Nympho Wives Can"t Help Themselves - Ms Satsuki, H-Cup, Age 42, Born Slut Horny Every Day - Ms Masami, E-Cup, Age 3

  • censoredmature womanslutFFFSprivate mousozokugroupFFFS-031FFFS031fffs00031
    • 2021-09-16
    75 min

    200GANA-2558 "What？ Do You Want To Spear？ Lol] Picking Up A Nice Shibuya Gal! It Looks Strong And Is Actually De M! ？？ A Large Amount Of Peeing That Makes You Feel Like You’Re Hit In The Ass And The Bed Is Full! The Turbulence Is Too Erotic!

  • amateur censoredbig titssquirtingganagana-2558gana2558200gana-2558
    • 2021-09-17
    170 min

    [MVSD-481]Mazakon (Oedipus Complex). I Remember Getting My Nipples Played With And Fondled By An Older Guy For Days On End. Mai Kagari

  • flower hunting censoredcreampieschoolgirlMVSDm s video groupms video groupMVSD-481MVSD481mvsd00481
    • 2021-09-22
    42 min

    396BIG-110 Hinano

  • amateur censoredcreampieschoolgirlbigbig-110big110396big-110
    • 2021-10-08
    47 min

    FC2PPV 2315051 She Loves To Be A Ya-Like [Bride Education]! Man Juice Lotion Leaks, Chestnuts And Pussy Completely Crash With Unequaled Dick

  • amateur uncensoredfc2
    • 2021-10-14
    132 min

    [MOND-222]With My Sister-in-Law Whom I Adore, Iroha Narimiya

  • narumiya iroha censoredmature womansingle workMONDtakara eizousumineko sanpeidaiichi housouMOND-222MOND22218mond00222
    • 2021-10-22
    124 min

    [FOCS-030]The Industry"s No. 1 Make-Up Beauty Missed Her Last Train Home, So We Tried To Pick Her Up And You Won"t Believe What Happened - Smoking Hot Sex From Dusk Till Dawn! Dual Talents: Porn Star And Skilled Make-Up Artist？! Kaede Hiiragi

  • hiiragi kaede censoredblowjobsingle workFOCSabc mousou zokufocusFOCS-030FOCS030focs00030
    • 2021-11-01
    68 min

    230OREC-919 Fuwarin (Hino Fuwari)

  • amateur censoredcreampiebig titsorecorec-919orec919230orec-919
    • 2021-11-10
    129 min

    [HSM-034]New Star! Naturally Beautiful Girly Boy, Hime.Love"s Haruka Asamiya Making Her Porn Debut, She Is A Slender Beauty With Beautiful Legs Who Loves Fucking Despite Her Innocent Looks

  • censoredamateurHSMhime styleHSM-034HSM03459hsm00034
    • 2021-11-12
    120 min

    [MEYD-720]When You Abandon An Unparalleled AV, The Neighbor"s Wife Will Pick It Up! Unsatisfied With His Small D*ck, She Cucks Him With My Infinitely-Hard One! Satsuki Mei

  • satsuki mei censoredcreampiebig titsMEYDtameike goroMEYD-720MEYD720meyd00720
    • 2021-11-26
    62 min

    FC2PPV 2467091 [Leakage] ● Personal Shooting Leak ● 5 People Active 〇〇 Idol Connection Plabe Photo Session Call Raw Squirrel Piston To The Head And Mass Seeding Acme Fall [cen]

  • amateur uncensoredfc2
    • 2021-11-27
    122 min

    [ITSR-098]Milf Gets Serious. "Stop The Teasing" She Says With A Laugh At First, But It Gets Real With A Signal To Full-on Sex! This Milf Gets A Serious Creampie At The End!？ - 8. Misato-san (48), Shitara-san (49)

  • censoredcreampieamateurITSRbigmorkalmaxchou itadakiITSR-098ITSR09857itsr00098
    • 2021-12-04
    139 min

    [PKPD-172]Found A Lost Girl And Creampied Her. Nozomi Kazama

  • nozomi kazama censoredcreampiebeautiful girlPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-172PKPD172pkpd00172
    • 2021-12-17
    69 min

    483SGK-053 [Dirty Woman Who Wants To Have Sex 365 Days] [Tall 168 Cm F Milk Lewd Woman] [Transcendental Masochist With Outstanding Sensitivity] [Chi ● Po Smell Love De Transformation] [Sorry Cum] A Lewd Woman Who Wants To Have Sex 365 Days Has Arrive

  • amateur censoredbig titsmarried womansgksgk-053sgk053483sgk-053
    • 2021-12-23
    135 min

    [SDMU-970]色白Fカップ声優学生。顔面から脇の下、足の指まで余すことなく舐めつくした合計2日間 小花のん

  • kohana non censoredbig titssoloworkSDMUsod createSDMU-970SDMU970
    • 2021-12-24
    242 min

    [ID-036]Rough Sex Busty Wife Hot Spring - 4 Hours

  • censoredcreampiecosplayIDtmatorindoru tanakaID-036ID0365527id00036
    • 2022-01-07
    63 min

    300NTK-682 [Active Beautiful Leg Model Beauty] [Transcendental Nasty Body Trained By Swimming] [Tall Echiechi Miracle Pink Nipple 2NN] The Best Body Gathers In The Industry! !! Beautiful Leg Models From The Model Industry Are Here! !! Gachi And Beaut

  • amateur censoredcreampieamateurntkntk-682ntk682300ntk-682



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored