mature woman def javcensored creampie jav




FC2DASDGVHVENUHUNTBSANADNJULAMBIHDKAMARAMIAAWAAAMEYDMIDVMILKAPODCESDSQTEEBODCHRV

2020-12-13
123 min

[APNS-216]変態お嬢様あみ 下卑た小父さん達に嬲られて、輪●されるって蕩けちゃう... 柏木あみ

  • ami kashiwagi censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-216APNS216apns00216
    • 2020-12-18
    124 min

    [MOPG-066]These Elder Sister Type Guilty Little Perverts Are Hitting Maso Men With Standing Spasmic Leg-Shaking Sex Maina Yuri

  • yuuri censoredanalslutMOPGm o paradisemo goldMOPG-066MOPG066mopg00066
    • 2020-12-20
    118 min

    [JUL-417]This Sadistic Caregiver Had Me Immobilized And Continued To Tease Me With Pull Out Ejaculation Management Amy Fukada

  • emi fukada censoredmature womanslutJULmadonnakogoro kindaichiJUL-417JUL417jul00417
    • 2020-12-21
    121 min

    [BLOR-160]Fit Girl With A Tight Body - You'd Never Expect Her To Be An H-Cup - Flirting Turns To Hard Pounding With A Huge Cock, Which This Eager Slut Is Happy To Take!

  • censoredbig titsBLORbroccoli mousouzokubroccolibroccoliBLOR-160BLOR160blor00160
    • 2021-01-01
    243 min

    [NACX-070]Legendary Beautiful Mature Women, 12 People, BEST

  • hisae yabe yumi anno censoredbig titsNACXplanet plusnanakuruNACX-070NACX070h-237nacx00070
    • 2021-01-07
    88 min

    SRT-021 Yui

  • amateur censoredcreampiebig titssrtsrt-021srt021srt-021
    • 2021-01-08
    44 min

    FC2PPV 1637022 [Personal shooting] A 34-year-old busty wife who was assigned a meat stick that I did not want to get entangled, eventually drowning in a black glowing meat stick …

  • amateur uncensoredfc2
    • 2021-01-14
    133 min

    [MOND-207]Secret Afternoon: She Fucks The Delivery Guy Hana Haruna

  • haruna hana censoredbig titssingle workMONDtakara eizokouji takaradaiichi housouMOND-207MOND20718mond00207
    • 2021-02-01
    246 min

    [ZMAR-034]The Works! Hibiki Otsuki

  • otsuki sound censoredcreampieblowjobZMARplanet plusthe whole damn thingZMAR-034ZMAR034h-237zmar00034
    • 2021-02-08
    54 min

    [ETQR-191](Daydream POV) Raw Creampie Sex With A Barely Legal Beautiful Girl In A School Sailor Uniform. Natsu 01

  • censoredcreampieuniformETQRerotic timeETQR-191ETQR191h-1186etqr00191
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-14
    35 min

    FC2PPV 1685821 Limited time [Individual shooting] Prefectural general course ③ Gonzo a girl who is abandoned by her boyfriend and desperate

  • amateur uncensoredfc2
    • 2021-02-20
    62 min

    324SRTD-0211 A metamorphosis personal shooting video leaked with a shaved schoolgirl!

  • amateur censoredcreampiebig titssrtdsrtd-0211srtd0211324srtd-0211
    • 2021-02-21
    149 min

    [HND-951]My Girlfriend's Younger Sister Loves Me Too Much And Secretly Wants To Make Babies With Me - Nene Hatsuai

  • first love censoredcreampiebig titsHNDhon nakausa pyonHND-951HND951hnd00951
    • 2021-02-27
    62 min

    1Pondo 022721_001 Train Ryu Enami in a kimono vulgarly! Ryu Enami

  • amateur uncensored1pondo
    • 2021-03-11
    98 min

    [XMOM-029]My Husband Hasn't Had Sex With Me In Six Months... I'm So Horny That I Brought The Guys From My Walking Club Back Home To Fuck While He's At Work Nozomi Haneda

  • nozomi haneda censoredcreampiemarried womanXMOMcenter villagemurakipink breathXMOM-029XMOM029h-086xmom00029
    • 2021-03-12
    108 min

    [DPL-016]Ladies Party For Free Camp Mana Hirano 22 Years Old

  • mana hirano censoredDPLplay entertainmentblade take leeDPL-016DPL016h-1557dpl00016
    • 2021-04-02
    148 min

    [RBK-011]Ever Since She Was Hired Fresh Out Of School, He Adored And Cared For Her, But When He Found Out That She Had A Lover, He Decided To Pursue Sexual Relations With Her. Akari Neo

  • akari neo censoredbeautiful girlsingle workRBKattackersjo styleryupakuRBK-011RBK011rbk00011
    • 2021-04-04
    80 min

    200GANA-2463 Seriously Nampa, first shot. 1618 Secure J Breast College students caught in the prize of Omikuji! I miss her boyfriend … What if I let her spoil her …？ Don’t miss the way you panting with huge breasts! !!

  • amateur censoredbig titssquirtingganagana-2463gana2463200gana-2463
    • 2021-04-09
    140 min

    [SKEJ-008]Moaning With Ecstasy! Beautiful Girl Gets Pounded Hard By Huge Cock!

  • censoredamateurbeautiful girlSKEJamateur time delusion groupSKEJ-008SKEJ008skej00008
    • 2021-04-09
    155 min

    [JUNY-034]Return Of The Legendary P-Cup With Massive Areolas - Her Voluptuous Body's Lust Is Off The Charts And She Wants To Fuck Hard Iori Yuki

  • yuuki yuuki censoredbig titssingle workJUNYfitchmichiru arashiyamanikuyokuJUNY-034JUNY034juny00034
    • 2021-04-10
    91 min

    300MAAN-642 [Ubu and Naughty Absolute Younger Beautiful Girl] "Nanami-san" Marunage Request! 18 years old and 10 months old, a beautiful girl who is apt, has come w Thin hair Ma ● Ko, I will have a big dick! I’m not used to it and I̵

  • amateur censoredcreampieuniformmaanmaan-642maan642300maan-642
    • 2021-04-20
    126 min

    [STARS-350](Get Your Nookie On In Overwhelming 4K Video!) An Exquisitely Tasty Hip Special! An Anal-Baring Pretty And Tight Ass Full Course For All You Ass Lovers Maximum Fetishism!!! Mahiro Tadaii

  • mahiro yui censoredbeautiful girlsingle workSTARSsod createtiger kosakaisod starSTARS-350STARS3501stars00350
    • 2021-04-22
    89 min

    229SCUTE-1109 Nono (24) S-Cute S-class beautiful girl Hanikami H

  • amateur censoredcreampieamateurscutescute-1109scute1109229scute-1109
    • 2021-04-24
    121 min

    [AUKG-510]Thick Plump Lesbians ~ Chubby Lesbian Carnival With Big Asses And Big Tits ~ Kanae Kawahara Reina Aoi

  • kanae kawahara aoi reina censoredbig titslesbianAUKGu krentoAUKG-510AUKG510aukg00510
    • 2021-05-03
    68 min

    SIRO-4504 [First shot] [Whitening slender beauty] [Die on a big cock] She has a cute face and likes Ochi ○ Chin. When she pierces her wet man who was absorbed in pacifier with a big cock .. AV application on the net → AV experience shooting 1525

  • amateur censoredamateursirosiro-4504siro4504siro-4504
    • 2021-05-05
    124 min

    [GVH-229]True Story: Nailing My Stepmom Yuri Honma

  • really censoredmomsingle workGVHglory questhyonGVH-229GVH22913gvh00229
    • 2021-05-07
    140 min

    [DASD-863]My Mother-In-Law Annoys Me... Young Wife Has An Idea To Get Back At Her Husband's Mother "Can I Touch Your Cock, Father-In-Law？" Riho Fujimori

  • riho fujimori censoredbig titsblowjobDASDdaschinpo dazaiDASD-863DASD863dasd00863
    • 2021-05-07
    61 min

    FC2PPV 1805559 [No first shot appearance] Weekend limited 2980pt → 1980pt Highest class amateur girl E cup nursery teacher Nana 20 years old 60 minutes of tension for the first Gonzo [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-08
    23 min

    FC2PPV 1807627 Blow and ball licking of highleg gal ♥ Finally squeeze semen with handjob [Review benefits available]

  • amateur uncensoredfc2
    • 2021-05-11
    136 min

    [STARS-373]Breaking In Her Teacher: "Do You Like To Have Your Nipples Teased, Teacher？" My S*****t Kaede Whispered In My Ear While She Stroked My Nipples. Kaede Hiiragi

  • hiiragi kaede censoredbeautiful girlsingle workSTARSsod createkisshisod starSTARS-373STARS3731stars00373
    • 2021-06-02
    127 min

    [GVH-242]露出・輪●・ぶっかけ願望に憑りつかれた女 渚みつき

  • scooping censoredslutsingle workGVHglory questusubashisuiGVH-242GVH24213gvh00242
    • 2021-06-11
    147 min

    [IPIT-017]I Love To Fuck, So Sure, I'll Star In Porn Emika Asagiri

  • emika asagiri censoredsingle workIPITidea pocketusa pyonideapocket talent discovery projectIPIT-017IPIT017ipit00017
    • 2021-06-14
    54 min

    [SDFK-049]These Beautiful Babe In A Hot Swimsuit Is Boarding The Magic Mirror Number Bus For The First Time, And Getting A Sensual Massage On Her Hot And Tanned Beautiful Ass This Sensual And Tanned Bikini Babe Came 4 Times And Pissed Herself Silly .

  • censoredsquirtingSDFKsod createchain sectmagic mirrorSDFK-049SDFK0491sdfk00049
    • 2021-06-15
    60 min

    Pacopacomama 061521_490 Married Pussy Encyclopedia, 137 Deluxe Edition Mikako Tachibana Junko Kunida Sachiko Takahashi

  • amateur uncensoredpacopacomama
    • 2021-07-02
    120 min

    [SHKD-957]Me, An Upper-class Citizen, Am Getting Fucked By Dirty Servants' Cocks. Nanami Kawakami

  • kawakami nanami censoredsingle workdramaSHKDattackerskitorune kawaguchisharkSHKD-957SHKD957shkd00957
    • 2021-07-06
    68 min

    493NAEN-073 Outflow! ？？ H cup gal and dark staying party! ？？ Yuria Kano who commits first-class Ma ○ this all night

  • amateur censoredamateurbeautiful girlnaennaen-073naen073493naen-073
    • 2021-07-22
    120 min

    [MIAA-477]Female Detective Sneaks In As A Decoy! Aphrodisiac Oil Bondag With Endless Orgasms Version Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-477MIAA477miaa00477
    • 2021-08-03
    58 min

    FC2PPV 1743350 [Personal Shooting] Natural Material Shaved Beauty Big Tits Pichi Pichi 18 Years Old Miori-Chan Has A Large Amount Of Raw Vaginal Cum Shot!

  • amateur uncensoredfc2
    • 2021-08-13
    260 min

    [DVDMS-704]Spying On Ordinary Girls - A Female Office Worker And Her Two Younger Male Coworkers Stay In The Same Hotel On A Business Trip, But Who Would"ve Thought They"d Be In The Same Room! One Thing Leads To Another And Soon They"re Do

  • censoredcreampieamateurDVDMSdeepsking of genkingdeep sDVDMS-704DVDMS704dvdms00704
    • 2021-08-19
    241 min

    [AKDL-134]I Will Play With Your Nipples-Full Nipple Play! SUPER BEST

  • yui hatano yahashi bridge censoredbig titsbeautiful girlAKDLaquinorifsetaknrAKDL-134AKDL1341akdl00134
    • 2021-09-02
    61 min

    326NKD-002 [Creampie Tracking 24:00] Over 40 Experienced People! ？？ Natural Spear Man Appeared! !! Once You Eat It, You Won’t Let Go Of It Until You Cum Inside It! !! [Case: 02 / Darkness Of Club Street]

  • amateur censoredcreampieamateurnkdnkd-002nkd002326nkd-002
    • 2021-09-24
    171 min

    [HMN-047]New Neighbour Next Door Is Popular Porn Star Akari Mitani! I Was Used As Training By Her Before Her AV Shoot

  • mitani akari censoredcreampieslutHMNhonnakaakai suiseiHMN-047HMN047hmn00047
    • 2021-10-08
    66 min

    328HMDN-415 [Don Juan’s Wife’s Return! ？？ ] H Cup Superb Constriction Celebrity Young Wife Aphrodisiac Oil Sensitivity 100 Times Brain Iki Acme. Handsome DD Saffle Demon Chi ● Portio Repeated Hitting Consciousness Blows Away Conceived Fucki

  • amateur censoredcreampiebig titshmdnhmdn-415hmdn415328hmdn-415
    • 2021-10-09
    58 min

    10musume 100921_01 Real Face Amateur: It’s Embarrassing To See My Face With Makeup Removed Because I’m A Childhood Friend Rena Hashimoto

  • amateur uncensored10musume
    • 2021-10-25
    82 min

    [THNIB-081]love bite/Yuna Ito

  • censoredbig titsbeautiful girlTHNIBcraneTHNIB-081THNIB081h-706thnib00081
    • 2021-11-15
    68 min

    FC2PPV 2434910 [Erotic Dirt Girls Leak! ] Tw ● Tter Inviting Erotic Girls Who Were Chatting In The Space And Having An Orgy! Fair-Skinned Beauty Ol Bitch With Raw Squirrel Dick And Demon Piston! I Firmly Seeded The Convulsive Pussy In The Intense Acm

  • amateur uncensoredfc2
    • 2021-11-19
    240 min

    [HUNTB-146]"If You Like My Boobs, I"ll Keep Showing Them To You..." Older Sister Lets Me BUKKAKE Her Boobs All I Want! Older Sister In Heat Lets Incredible Every-Day BUKKAKE Younger Brother Put His D*ck

  • censoredcreampiebig titsHUNTBhunterkawajirihhh groupHUNTB-146HUNTB146huntb00146
    • 2021-12-03
    69 min

    300NTK-667 [Do Hentai G Breasts Beauty] [Nuruteka Sex Best] [Bring Pin Low Ona Road] It’s Out! !! Genuine De Nasty Beauty Echona! !! Normally, A Nursery Teacher’s Beautiful G-Breasted Metamorphosis Beauty Puts A Pin Low In Her Famous Instru

  • amateur censoredcreampiebig titsntkntk-667ntk667300ntk-667
    • 2021-12-03
    131 min

    [CLUB-662]Sweaty Former Yankee Married Woman, Yuri-san (31) D***ks And Gets Dirty With Junior Worker On Comfort Trip.

  • censoredcreampieCLUBhentai shinshi kurabuCLUB-662CLUB662club00662
    • 2021-12-07
    60 min

    C0930 ki211207 Chika Endo 30years old

  • amateur uncensoredc0930
    • 2021-12-14
    479 min

    [KTRA-359]10 Beautiful Girls With Big Tits Having Sex In A Row, 8 Hours, 2 Discs, KTRA-. 359

  • takarada monami jun kawaguchi censoredcreampiebig titsKTRAk tribeKTRA-359KTRA359h-094ktra00359
    • 2021-12-25
    126 min

    [APNS-268]It"s A Debauchery To Be Ringed By Lowly Little Fathers... Ena Satsuki

  • ena satsuki censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-268APNS268apns00268
    • 2022-01-05
    62 min

    SPAY-032 Mr. Nakamura

  • amateur censoredcreampiebig titsspayspay-032spay032spay-032
    • 2022-01-14
    118 min

    [MEYD-733]Female Teacher NTR The Wife Of The Head Of The School Went With The Vice Principal To Preview The School Trip... Luna Tsukino

  • tsukino luna censoredcreampiesingle workMEYDtameike gororyo inugamiMEYD-733MEYD733meyd00733
    • 2022-01-15
    126 min

    [GVH-344]Naughty Nurses. Mina Kitano

  • mina kitano censoredbig titsgrandfatherGVHglory questtakahashi chitsujiGVH-344GVH344gvh00344



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored