mature woman javcensored documentary jav housewife




FC2HNDMIDEMIAAONEZIPXBLKMVSDSSISPREDDASDADNRBDVEMAMEYDHMNSTARSFSDSSMILKSQTECJOD

2021-01-13
44 min

302GERK-342 Sarina

  • amateur censoredcreampieamateurgerkgerk-342gerk342gerk-342
    • 2021-01-23
    38 min

    FC2PPV 1656317 Limited to 200 pieces, 1480 PT! [Appearance, uncensored, full-scale fetish, raw squirrel] Thick blowjob & happening during intercrural sex w Nyurutto raw squirrel success w If you look at beautiful big tits, you can immediately liv

  • amateur uncensoredfc2
    • 2021-01-25
    245 min

    [HMVX-008]Eyes On Barely Legal Teens - SEX With Shaved Pussy x Gaping, Dripping Slits 10 Girls, 240 Minutes

  • censoredcreampieamateurHMVXhamedori.network secondeditionHMVX-008HMVX008h-1472hmvx00008
    • 2021-01-29
    65 min

    490FAN-081 Yuri

  • amateur censoredbig titsamateurfanfan-081fan081490fan-081
    • 2021-01-31
    182 min

    [SQIS-042]Ravished - Sacrificed To Monstrous Lust

  • censoredbig titsmature womanSQISfa proSQIS-042SQIS042sqis00042
    • 2021-02-05
    115 min

    [PARATHD-3100]The Reason Why This Sixty-Something Widow Secretly Filmed Her Stepdaughter And Her Husband's Nightly Activities Deluxe Edition - When He Found Out The Reason, Her Son-In-Law Decided To Provide His Own Brand Of Comfort -

  • censoredamateurmature womanPARATHDparadise tvPARATHD-3100PARATHD3100parathd03100
    • 2021-02-06
    56 min

    H0930 ki210207 Misa Oohara 45years old

  • amateur uncensoredh0930
    • 2021-02-12
    81 min

    383REIW-046 An

  • amateur censoredcreampieamateurreiwreiw-046reiw046383reiw-046
    • 2021-02-19
    485 min

    [DCX-122]Supreme Double Pussies A Deluxe Co-Starring Best Hits Collection - Enjoy 8 Hours Of Harlem Sex While You Get Every Last Drop Of Semen Milked From Your Balls -

  • tsubaki mashiro rumi tadami censoredcreampiebig titsDCXprestigedoc maxDCX-122DCX122118dcx00122
    • 2021-02-19
    85 min

    FC2PPV 1693035 [Amateur / Concafe clerk] Leaked Gonzo Private photo session of holiday layer Massive vaginal cum shot in 20-year-old beautiful girl pussy (with high-quality SEX data)

  • amateur uncensoredfc2
    • 2021-02-22
    89 min

    [SPRBD-046]I Want To Keep On Jiggling Shiori Kuraki

  • censoredbig titsbeautiful girlSPRBDintec incSPRBD-046SPRBD046h-706sprbd00046
    • 2021-02-25
    109 min

    [HTHD-183]My Friend's Mother - Last Chapter - Makiko Tsurukawa

  • makiko tsurukawa censoredcreampiemature womanHTHDcenter villagejiro fukagawahona zonoHTHD-183HTHD183h-086hthd00183
    • 2021-02-26
    166 min

    [ABW-060]Her First-Ever Trance Experience Furiously Orgasmic Sex 56 Experience Undiscovered Techniques To Boost Your Sensuality!! Her Beautiful Body Is Transformed Into A Full-Body Clit!! Lumina Yuki

  • yuki rumina censoredlesbiansingle workABWprestigenorere kawasakiabsolutelyABW-060ABW060118abw00060
    • 2021-03-01

    FC2PPV 1707259 Amateur Gonzo 40

  • amateur uncensoredfc2
    • 2021-03-04
    150 min

    [C-2620]Please Steal My Wife (Asuka, Age 25) 92

  • censoredmarried womanCgogostakeshi karakicore gogo sC-2620C2620
    • 2021-03-06
    429 min

    [HSF-013]POV Sex Friends vol. 13

  • censoredcreampiecosplayHSFyou planningHSF-013HSF013189hsf00013
    • 2021-03-07
    139 min

    [PKPL-003]Totally Private Footage - Shy Squirting Submissive Beautiful Girl - First Overnight Trip Alone With Natsu Tojo

  • natsu tojo censoredbeautiful girlsingle workPKPLfuck group and fun friends daydreamersPKPL-003PKPL003pkpl00003
    • 2021-03-17
    48 min

    492MERC-284 Ro-Kon bastard aiming for prey in the park

  • amateur censoredcreampieamateurmercmerc-284merc284492merc-284
    • 2021-03-18
    75 min

    326URF-061 [Back customs x erotic god GAL advent ☆] The best gal with a personality that kills sperm with full service! Sensation with lewd Kansai dialect ⇒ Paipanma ● 4 shots with SEX swamp loop of vaginal cum shot! !! After all, the hit lady is a b

  • amateur censoredcreampiebig titsurfurf-061urf061326urf-061
    • 2021-04-01
    60 min

    336KNB-148 "It was Comfortable …" A Married Woman With Trauma Overcomes Sex With An AV Appearance! The frightened expression gradually disappears, and I feel it with a fascinating face! !! Real sex of an amateur wife! !! !! I will take a

  • amateur censoredamateurknbknb-148knb148336knb-148
    • 2021-04-05
    82 min

    FC2PPV 1755787 [Thank you for selling out 100 bottles for the first time for 3 hours] Permanent preservation version ❤️ I can not take the next schedule ❤️ A slender and very beautiful young wife ❤️ Complete appearance of determination ❤️ Perfect voi

  • amateur uncensoredfc2
    • 2021-04-24
    53 min

    492JCHA-017 JK Fresh Erotic Oil Massa Treatment 5

  • amateur censoredbig titsuniformjchajcha-017jcha017492jcha-017
    • 2021-05-02
    150 min

    [KTB-044]Adult Daycare Sachiko

  • sachiko censoredcreampiebig titsKTBkahanshin tigers mousouzokukahanshin tigersKTB-044KTB044ktb00044
    • 2021-05-20
    108 min

    FC2PPV 1827466 [Slutty Bus Tour] Real Doujin Slutty Bus Tour was held. If you get on it, this is the one! Touch, squirting, vaginal cum shot, orgy, anything is OK

  • amateur uncensoredfc2
    • 2021-06-01
    243 min

    [NACX-079]Slutty Wife Seduces her Husband's Subordinate And Begs Him To Fuck Her Raw

  • shiho egami kiriko kinosaki censoredcreampiemature womanNACXplanet plusnanakuruNACX-079NACX079h-237nacx00079
    • 2021-06-04
    150 min

    [JUL-608]My Friend's Mother Is A Prim And Proper Prude Yuko-san Turned Out To Be A Super Horny Bitch Who Will Suck My Semen So Hard My Balls Went Dry ... Yuko Shiraki

  • shiraki yuko censoredbig titsmature womanJULmadonnabieber gonzoJUL-608JUL608jul00608
    • 2021-06-05
    101 min

    [VENX-044]"Your Tits Are Riding Me..." Sex In The Bath With My Busty Mother-in-law Who's Just My Type - Nenne Ui

  • first love censoredcreampiebig titsVENXvenusmajime kitanofakecest winntersVENX-044VENX044venx00044
    • 2021-06-25
    75 min

    [HYPN-043]Gyaru Who Makes Fun Of The Janitor Turns Into His Slut! A Whore Who Sucks Your Dirty Cock Clean With Her Mouth! Mitsuki Maya

  • aya mitsuki censoredcreampieblowjobHYPNsod createsatoshi morikawamind controlHYPN-043HYPN0431hypn00043
    • 2021-07-12
    133 min

    FC2PPV 1918011 Active professional dancer * Limited quantity *

  • amateur uncensoredfc2
    • 2021-07-18
    240 min

    [CRDD-013]Beautiful Tits! Big Tits!! Colossal Tits!？ These Are The World's Great Boobs! Western Beautys' Sensitive Nipples and Obscene Areolas are Irresistable! 4 Hours

  • censoredcreampieCRDDcrazy walkermanjiroCRDD-013CRDD013crdd00013
    • 2021-07-22
    164 min

    [MIFD-172]A Fresh Face I Want To Enjoy My Sexual Youth! She's Had Experience In The National Baseball Tournament! On The Bulletin Board, She's Listed Her Thread As A "Cute Female Manager" Who Lives In The Kanto Region This Beautiful G

  • mizuki mei censoredbig titssoloworkMIFDmoodyzmametaro mamezawamoodyz freshMIFD-172MIFD172
    • 2021-08-07
    150 min

    [APKH-183](Forbidden Photoshoot In Her Uniform At A Love Hotel) Shy S*****t With Short Hair Screams Like A Madwoman When Her Teacher Makes Her Cum - Intimate POV Suzu Monami

  • monami bell censoredcreampieschoolgirlAPKHaurora project annexhAPKH-183APKH183apkh00183
    • 2021-08-13
    144 min

    [HUNBL-058]A Super Masochistic Slut Whose Deep Throat Gives Her Convulsive Climaxes At A Men"s Massage Parlor

  • censoredcreampieuniformHUNBLhuntergeminihhh groupHUNBL-058HUNBL058hunbl00058
    • 2021-08-20
    125 min

    [ARMF-018]Female S*****t Body Encyclopedia, No. 2

  • narita tsumugi miu susaki censoredanalschoolgirlARMFaroma kikakunyotai fetishismARMF-018ARMF018armf00018
    • 2021-08-21
    114 min

    390JAC-098 [I Love Sperm X Beautiful Big Tits F Cup X Very Narrow Eroma ● Co] How Are You Guys？ Jackson Is Doing His Best To Survive The Heat Of Summer! !! A Crazy Fairy Has Come Down To Support Us! !! The Tech That Handles Sticks And Balls Is The Be

  • amateur censoredcreampiesquirtingjacjac-098jac098390jac-098
    • 2021-08-30
    47 min

    292MY-466 Kaneko hitona 2

  • amateur censoredcreampiebig titsmymy-466my466292my-466
    • 2021-09-25
    61 min

    519MAZOF-017 [Monster Of Libido] President’s Secretary 27 Years Old [Cum Crazy] A Woman Whose Stress Exploded During A Busy Period. It Is Delighted To Be Violated And It Breaks And Acme Convulsions Do Not Stop And Spree. Seed And Return (Renon K

  • amateur censoredcreampieamateurmazofmazof-017mazof017519mazof-017
    • 2021-09-30
    74 min

    533NNS-009 Outdoor Masturbation Love Pervert Saffle Big Tits Beauty And Fucking Squirting Sex Photo Session! !! Continuous Vaginal Cum Shot Ascension At The Woman On Top Posture! !!

  • amateur censoredcreampiebig titsnnsnns-009nns009533nns-009
    • 2021-10-01
    125 min

    [MILK-121]Step-dad Loves It! No Way Step-mom Can Know He"s Having Lewd Fun Each Day With Nanami. Nanami Yokomiya

  • yokomiya nanami censoredschoolgirlbeautiful girlMILKmilkMILK-121MILK121h-1240milk00121
    • 2021-10-08
    118 min

    [SSIS-203]Rara Anzai. Her Powers of Reason Fly Out the Window. Celibacy x Addiction to Aphrodisiacs. Abnormally Strong Climaxes

  • anzai rara censoredbig titssingle workSSISs1 no 1 stylemonSSIS-203SSIS203ssis00203
    • 2021-10-13
    54 min

    229SCUTE-1138 Asuka (21) S-Cute No Bra Girl And Creampie Etch (Asuka Momose)

  • amateur censoredcreampieamateurscutescute-1138scute1138229scute-1138
    • 2021-10-16
    120 min

    [KAGP-199]An Ordinary Amateur Girl Enjoys Dildo Masturbation 8

  • censoredamateurKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-199KAGP199kagp00199
    • 2021-10-21
    125 min

    [DLDSS-045]DAHLIA Exclusive Yuka Hodaka. Young College S*****t Makes Miraculous Recovery As Adult With True Sex Appeal. Yuka Hodaka

  • yuka hotaka censoredsingle workDLDSSdahliaarashiyama michiruDLDSS-045DLDSS0451dldss00045
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-06
    172 min

    [TPIN-018]Why Are You Stealing Underwear From Old Ladies Like Us？ "I Wanted It Because I Like Old Ladies" Underwear!" The Instant They Heard Those Words From A Young Man, These Hot Mamas Felt Their Hearts Skip A Beat, And They Could No Lo

  • censoredcreampielingerieTPINtsubakihoinTPIN-018TPIN018tpin00018
    • 2021-11-11
    123 min

    [FSDSS-316]Cum Dumpster Wants Me Too Much Can"t Make A Wife Of This Bitch Intense Erotic SEX Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingsingle workFSDSSfalenoarashiyama michirufaleno starFSDSS-316FSDSS3161fsdss00316
    • 2021-11-27
    61 min

    Pacopacomama 112721_564 Mature Woman With A Certain Situation Nono Otsuki

  • amateur uncensoredpacopacomama
    • 2021-12-04
    140 min

    [PKPL-012]A Pay-For-Play Relationship An 18-Year Old Who Will Agree To Have Creampie Sex A Maso Girl With Short Black Hair In The Art Club Nana Hayami

  • don t be quick censoredcreampieuniformPKPLpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPL-012PKPL012pkpl00012
    • 2021-12-07
    50 min

    FC2PPV 2496541 [No] Sister-Based Beautiful Girl Miku-Chan And Icharab Gonzo ♡ Intense Blowjob That Sucks Ojisan Semen With A Pure Innocent Face ♥ Ignore "Get Out ♡" And Legally Vaginal Cum Shot!

  • amateur uncensoredfc2
    • 2021-12-09
    46 min

    H0930 ki211209 Nobuko Namiki 34years old

  • amateur uncensoredh0930
    • 2022-01-08
    300 min

    [DVAJ-554]Best Work By Director Jo Asagiri

  • mari rika yu tomita censoredbeautiful girldramaDVAJalice japanjo asagiriDVAJ-554DVAJ554dvaj00554
    • 2022-01-28
    117 min

    [CAWD-335]I Came So Much It"s Almost Embarrassing! Shy Girl"s Great Sexual Awakening Her First Huge Orgasm Special Futaba Kurumiya

  • kurimiya futaba censoredbig titssquirtingCAWDkawaiihirokoji osakiCAWD-335CAWD335cawd00335
    • 2022-01-28
    61 min

    FC2PPV 2629449 [Personal Shooting] Foreign-Affiliated Insurance Company Working Beauty Sales Lady Gonzo Cum Shot !! Foreign-Affiliated Insurance Company Working: Yumi (24 Years Old)

  • amateur uncensoredfc2
    • 2022-01-28
    45 min

    292MY-526 Rika Matsuyama 2

  • amateur censoredmarried womanamateurmymy-526my526292my-526
    • 2022-02-02
    47 min

    230OREC-1007 Ena-Chan (Ena Satsuki)

  • amateur censoredcreampieamateurorecorec-1007orec1007230orec-1007
    • 2022-02-04
    165 min

    [HODV-21650]Married Woman REC This Married Woman Moved In To My Apartment Building, And She Dresses Like A Slut, Which Is Just How I Like It, And Every Day, I Stole Peeks At Her, Until One Day, She Totally Caught Me In The Act ... "Hey You ... Yo

  • censoredcreampiebig titsHODVh m pHODV-21650HODV216505642hodv21650



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored