mature woman over hours censored jav def




FC2PPPDNGODHODVCAWDSTARSMIDEDASDDTTSSISMILKNNPJAMBIROYDMVSDSSNIHZGDFSDSSSPRDNATRSAN

2020-12-02
59 min

[KBTV-041]The Shyest Girl You'll Ever Meet. But Once She Talks To You Will She Let You Go All The Way？ We Find Out!

  • censoredamateurblowjobKBTVmessy tvKBTV-041KBTV041h-1514kbtv00041
    • 2020-12-05
    89 min

    [sdgn-009]さりなちゃん(21)

  • amateur censoredcreampiebig titssdgnsdgn-009sdgn009sdgn-009
    • 2020-12-20
    71 min

    FC2PPV 1613456 [First shot] I like the faster piston in front of the finish ❤️❤️ Immediately revived from the unexpected outburst of the unique JD Kitsuman! !! Two consecutive vaginal cum shots of the old man! !!

  • amateur uncensoredfc2
    • 2020-12-24
    122 min

    [FSDSS-143]I Showed This New Masseuse My Hard Cock And She Fucked Me - Against The Rules Kaname Momojiri

  • kaname momojiri censoredbig titscosplayFSDSSfalenomachado hanyufaleno starFSDSS-143FSDSS1431fsdss00143
    • 2020-12-25
    126 min

    [KBI-049]Married Woman Creampie - Adultery At A Hot Spring - 4 Forbidden Creampie Loads! Someone Else's Wife Is Your Exclusive Cum Dumpster. Minami Shiratori

  • minami shiratori censoredcreampiemature womanKBIprestigeshimikkikanbiKBI-049KBI049118kbi00049
    • 2020-12-26
    153 min

    [MIDE-863]I Love You. A Vague, Dangerous Memory Of Drowning In Sex With My Bestie's Boyfriend For 3 Days While She Was Away. [DVD Version] Nana Yagi

  • nana yagi censoredblowjobbeautiful girlMIDEmoodyzjo asagirimoodyz divaMIDE-863MIDE863mide00863
    • 2021-01-01
    123 min

    [SOAN-053]Volunteer Anal Service - Charitable Babes Offer Up Their Asses Out Of Philanthropy - This Time, She's Determined To Be The Star...

  • censoredanalSOANyama to soramaketaro tanizokoanal visitSOAN-053SOAN053soan00053
    • 2021-01-12
    241 min

    [MUCH-120]Permanent Preservation Version Mika Konishi Premium BEST 4 Hours

  • konishi mika censoredbig titsMUCHmothermuchimuchiMUCH-120MUCH120h-796much00120
    • 2021-01-22
    55 min

    HEYZO 2463 Lured Call Girl Gets Creampie In Her Private Business – Ena

  • ena uncensoredheyzo
    • 2021-01-27
    43 min

    230OREC-676 Shizuku

  • amateur censoredcreampieamateurorecorec-676orec676orec-676
    • 2021-02-02
    119 min

    FC2PPV 1669671 First shot ❤️ A tall slender student said “Don’t put it inside!” So I made a vaginal cum shot w [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-05
    240 min

    [HODV-21552]Best Of Mizuki Yayoi

  • mizuki yayoi censoredcreampiebeautiful girlHODVh m pHODV-21552HODV215525642hodv21552
    • 2021-02-06
    240 min

    [HUNTA-940]"I Wanna Try Fucking A Grown Up. Is That Wrong？" "I'm Game" Naughty Step-Uncle Agrees To Sleep With His Barely Legal Niece - He Can't Turn Down The Offer Of A Creampie...

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-940HUNTA940hunta00940
    • 2021-02-07
    65 min

    413INST-094 Ushichichi Holstein daughter ☆ Mami 19 years old Mami ♪ Fertilization mating ♪ Talent office belonging big breasts idol daughter raw Paco Pyupyu ♪ Chinpo milk pouring fertilization copulation ♪ Porcio awakening with ass press ☆ Breast swa

  • amateur censoredcreampiebig titsinstinst-094inst094413inst-094
    • 2021-02-11
    56 min

    SIRO-4420 [First shot] [Tall x H cup x active JD] [Enchanted body that attracts men] A 21-year-old active university student who exposes a fascinating perfect body. Attract serious pant to the pleasure that becomes intense .. AV application on the ne

  • amateur censoredbig titsamateursirosiro-4420siro4420siro-4420
    • 2021-02-12
    480 min

    [GOAL-037]Irresistibly Seductive Perky Ass - Raw SEX! 15 Girls, 8-Hour BEST Collection

  • censoredGOALprestigegoalGOAL-037GOAL037118goal00037
    • 2021-03-05
    150 min

    [HODV-21554]X Days With The Tall Maid And Mischievous Pervert Amu Hanamiya

  • hanamiya amu censoredcreampiebig titsHODVh m pHODV-21554HODV215545642hodv21554
    • 2021-03-13
    85 min

    [LHTD-015]Challenge! Big Vibrator Hikari - Hikari Kibo

  • hope light censoredLHTDocean bookslight houseLHTD-015LHTD015171lhtd00015
    • 2021-03-14
    70 min

    300NTK-555 [Reiwa’s Strongest Dirty Ass A Perverted Beautiful Wife Who Brings An Aphrodisiac In The Back Sitting Position! !! Explosion tide] Unfaithful wife who invites vaginal cum shot and Gangimari metamorphosis cheating sexual intercourse re

  • amateur censoredcreampiemarried womanntkntk-555ntk555300ntk-555
    • 2021-03-18
    60 min

    336KNB-146 A Young President Lady Who Came To Dissipate Stress Because She Couldn’t Endure Her Husband’s Bondage! After a long time, he goes crazy with other sticks, exposes his plump body in front of the camera, and is attacked by ripe hon

  • amateur censoredcreampiemarried womanknbknb-146knb146336knb-146
    • 2021-03-19
    120 min

    [AQMB-023]The Married Woman Next Door Appeared At My Door In The Middle Of The Night Wearing Lingerie... Vol 2 3 Beautiful Wives

  • censoredcreampiemature womanAQMBaquamall heroaquamallAQMB-023AQMB023aqmb00023
    • 2021-03-20
    89 min

    [KIR-030]I Owe My Artist Friend Money And In Order To Pay My Debt My Wife Had To Become A Nude Model For Him Sara Kagami

  • kagami sara censoredcreampieblowjobKIRstar paradisekirei star paradiseKIR-030KIR030h-254kir00030
    • 2021-04-02
    125 min

    [ARM-967]This Sexy Maid Will Help Her Master With His Masturbation.

  • misaki azusa mamiya nagi censoredanalARMaroma planningmania satoshiaromaARM-967ARM967arm00967
    • 2021-04-06
    64 min

    SIRO-4479 [First shot] [Hairdresser’s egg is hidden big breasts] [For students starting a new life ..] The hairdresser’s egg who applied for a new life from spring participates in the war. Her hidden G cup breast is exposed and she fascinat

  • amateur censoredbig titsamateursirosiro-4479siro4479siro-4479
    • 2021-04-13
    59 min

    Caribbeancom 041321-001 Jeans Beauty Vol.32 Chika Sugiyama

  • chika sugiyama uncensoredcreampiecaribbeancom
    • 2021-05-07
    161 min

    [MIST-336]Private Titty Bar - I Got A Message From A Broke Hostess For A Secret Meeting Between Just The Two Of Us... She Offered Me Creampie Sex On The Sly Miu Arioka

  • arioka miu censoredcreampiebig titsMISTmr michirusaitaMIST-336MIST3361mist00336
    • 2021-05-10
    96 min

    374IMGN-012 Mie (26)

  • amateur censoredcreampieamateurimgnimgn-012imgn012374imgn-012
    • 2021-05-14
    56 min

    285ENDX-343 Shortcut Slender JD! I inadvertently lusted for another person’s masturbation consultation!

  • amateur censoredamateurendxendx-343endx343285endx-343
    • 2021-05-20
    62 min

    10musume 052021_01 Please blame me in a naked apron Yu Tsuruno

  • amateur uncensored10musume
    • 2021-05-27
    240 min

    [BGN-064]新人 プレステージ専属デビュー 七嶋舞 僕らのむっつり彼女。 【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurbgnbgn-064bgn064bgn-064
    • 2021-07-27
    71 min

    300NTK-612 [Namaiki Kansai Beauty Gal Kimo Uncle Ji ○ Seeded Pleasure Fell! !! ] Fucking Cheeky P Activity Expedition Gal Negotiations & Netinechi Uncle Tech And Pleasure Fell From Disgust In The Direction Of Pleasure! !! The Temptation To Insert

  • amateur censoredcreampieamateurntkntk-612ntk612300ntk-612
    • 2021-07-30
    228 min

    [BBAN-338]Masochist Girl With Big Ass And Huge Tits Lesbian Beauties - Please Fuck Me Too. Like You Fuck Her - Yui Nagase Hina Kawai Hono Wakamiya

  • yui nagase haruna kawai censoredschoolgirllesbianBBANbibianBBAN-338BBAN338bban00338
    • 2021-08-29
    38 min

    292MY-464 Ran Koda 2

  • amateur censoredcreampiebig titsmymy-464my464292my-464
    • 2021-09-03
    149 min

    [CLUB-651]Sweaty Ex-gangster Housewife Has Filthy D***k-Fucking Trip With Her Younger Worker. Miss Nishimura, 36 Years Old.

  • censoredcreampiebig titsCLUBhentai shinshi kurabuCLUB-651CLUB651club00651
    • 2021-09-09
    40 min

    [IENFH-009]I Was Playing Pranks On My Big Stepsister That Night, But Then She Turned The Tables On Me And Fucked Me Raw, And I Was About To Cum, But Then She Locked Me Down With Her Legs And I Couldn"t Escape, So I Ended Up Creampie Cumming Insid

  • minami kozue censoredcreampieIENFHi energychrysanthemumienfIENFH-009IENFH0091ienfh00009
    • 2021-09-11
    64 min

    SIRO-4616 [First Shot] [Petite Beautiful Girl] [Plump Nice Ass] Discovered A 145 Cm Minimum Girl Wearing A Pretty Atmosphere. The Nasty Desire Hidden In A Small And Delicate Body Is Gradually Revealed In Expectations And Anxiety .. AV Application On

  • amateur censoredamateursirosiro-4616siro4616siro-4616
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-19
    50 min

    523DHT-0296 38 Years Old Full-Time Housewife Mari-San, 38 Years Old, A Carnivorous Cheating Wife

  • amateur censoredbig titsmarried womandhtdht-0296dht0296523dht-0296
    • 2021-10-05
    67 min

    374IMGN-025 Koharu

  • amateur censoredamateurimgnimgn-025imgn025374imgn-025
    • 2021-10-18
    65 min

    541AKYB-027 Aika (24) Kansai People Who Love H Will Soon Be Flooded ♪

  • amateur censoredcreampieamateurakybakyb-027akyb027541akyb-027
    • 2021-10-21
    81 min

    [IENF-172]My Private Tutor Said To Me, "I Thought You Wouldn"t Notice, But Oh Well, The Gig Is Up." She Had Big Tits But Was Wearing A Knit Top Without A Bra, And I Couldn"t Help But Notice! I Could No Longer Resist, So I Buried My Fa

  • mihara honoka misuzu kawana censoredcreampiebig titsIENFie nergyienfIENF-172IENF1721ienf00172
    • 2021-11-26
    139 min

    [IBW-850]My Wife"s Tanned Half-Japanese Daughter Is Just My Type Ran Height: 145cm Ran Sakita

  • sakita ran censoredbeautiful girlIBWi b worksIBW-850IBW850
    • 2021-12-03
    159 min

    [WAAA-120]During Training Camp, This Track And Field Female Athlete Was Pumped Full Of Aphrodisiacs By Her Corrupt Coach And Started Sweatily Cumming To High Heaven Noeru Honda

  • honda noeru censoredcreampieschoolgirlWAAAwanz factoryWAAA-120WAAA120waaa00120
    • 2021-12-03
    82 min

    230OREC-950 Yuzu (Yuzu Shirakawa)

  • amateur censoredcreampieamateurorecorec-950orec950230orec-950
    • 2021-12-17
    148 min

    [MEYD-727]My Husband"s Brother Who Asked Me To Be His Brush-off Is A Monster! Luna Tsukino"s Sister-in-law"s Impregnation Runaway NTR Without Noticing That She Is Coming And Without Pulling Out!

  • tsukino luna censoredcreampiesingle workMEYDtameike gorokogoro kindaichiMEYD-727MEYD727meyd00727
    • 2021-12-17
    151 min

    [JUFE-352]Bubbly Bombshell Janitor Who Comfortably Heals Our Troubled Minds And Dicks! Rena Momozono

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-352JUFE352jufe00352
    • 2021-12-24
    119 min

    [HMN-089]Fresh Face - In times Like These Can An AV Actress Make Into The Business Wearing A Mask？ Young Voice Actress That Is Currently Out Of Work Gets Lewd For The First Time In About A Year With A Creampie Debut. Shizuku Otohane

  • otowa shisora censoredcreampiesingle workHMNhon nakatiger kosakaiHMN-089HMN089hmn00089
    • 2022-01-13
    108 min

    [XMOM-039]Unfaithful Wife Opens Her Legs Lewdly Iori Nanase

  • iori nanase censoredcreampiemarried womanXMOMcenter villagesky cloudspink breathXMOM-039XMOM039h-086xmom00039
    • 2022-01-14
    151 min

    [BLK-551]Convoy! Giraffe Gyaru Deli One Day Experience Yu Shinoda Mio Kimishima

  • shinoda yu kimishima mio censoredcreampieblowjobBLKkira kirainaballkira kira black galBLK-551BLK551blk00551
    • 2022-01-14
    66 min

    417SRYA-017 [Menhera Gal X Ozashiki Oops Pub] A Spear Man God Who Is Completely Desolate With Eroticism That Will Let You Do It Right Away Has Arrived! Satisfied Ascension! Win Odds 1.1 Times

  • amateur censoredbig titsamateursryasrya-017srya017417srya-017
    • 2022-01-15
    241 min

    [OVG-190]Female Body Fetish Encyclopedia 4 - Complete, Fully Naked 66 People

  • censoredbig titsOVGglory questOVG-190OVG190ovg00190
    • 2022-01-27
    108 min

    [CHERD-079]Losing My Virginity To A Hot Family Friend, Intense Sex With A Cream Pie Starring Yuna Kitano

  • yuna kitano censoredcreampiemature womanCHERDcenter villagejiro fukagawahanazono center villageCHERD-079CHERD079h-086cherd00079
    • 2022-01-29
    86 min

    FC2PPV 2632093 [No] [Individual Shooting] "I Was Hospitalized Until Recently Because I Was Attempted …" A Bright And Innocent Figure Who Loves Baseball And Brass Band, Which I Can Only Show To Me Who Thought It Was Menhera 2980pt → 2480p

  • amateur uncensoredfc2
    • 2022-01-29
    57 min

    [h0930-ori1620]浦田 麻美子 44歳

  • amateur uncensoredh0930
    • 2022-02-01
    46 min

    [YMDS-074]Lewd And Intoxicating Temptress. Explosive Cluster! Must-see SSS Class Beautiful Woman For A Reverse POV! Timid MAINA

  • censoredblowjobslutYMDSmomotaro video publishingdukeYMDS-074YMDS074ymds00074
    • 2022-02-12
    66 min

    SIRO-4792 [First Shot] [S-Class Beauty Nurse] [Screaming Died At Cunnilingus] An Active Nurse With An Idol-Class Look In An Elegant Standing Behavior Was Discovered. When I Take It Off, The Body Is Too High Spec And I Blame The Sensitive Chestnut Of

  • amateur censoredbig titsamateursirosiro-4792siro4792siro-4792



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored