misa




FC2CHRVHODVSPRDNACRWAAAHDKAAWDFSDSSHMNMIDVRBDSDABMEYDCJODKBICESDBBANVEMACAWDAUKS

2021-02-05
240 min

[HODV-21552]Best Of Mizuki Yayoi

  • mizuki yayoi censoredcreampiebeautiful girlHODVh m pHODV-21552HODV215525642hodv21552
    • 2021-02-06
    81 min

    FC2PPV 1674471 046 [Last Cum and Facial Cumshot] I sent out facial cumshots twice in a row to the saffle who can no longer meet

  • amateur uncensoredfc2
    • 2021-02-07
    96 min

    345SIMM-605 Good glue, good face, good sensitivity! Secret special training on the bed with spokon J ○ ♪♪ Eat a lot and radiate the replenished energy with etch! !! Uncle sperm injection is completed in the energetic Hatsuratsu beauty Ma ○ Ko who ded

  • amateur censoredcreampieuniformsimmsimm-605simm605345simm-605
    • 2021-02-14
    94 min

    345SIMM-606 A small J ○ who is too nasty regardless of the innocent appearance, licks with a long tongue and slurps and serves paradise ♪ ♪ It’s been a long time with an uncle and it’s alive and it’s a tide Creampie! !! !! [A special d

  • amateur censoredcreampieuniformsimmsimm-606simm606345simm-606
    • 2021-02-15
    342 min

    [YNPS-002]Beautiful Bitches: Picking Up Girls For Quickies - Midwinter Ski Slopes Edition

  • censoredcreampiesquirtingYNPSpetersnampazuYNPS-002YNPS002h-021ynps00002
    • 2021-02-25
    58 min

    [orec-696]なつ

  • amateur censoredcreampieamateurorecorec-696orec696orec-696
    • 2021-03-04
    49 min

    Pacopacomama 030421_442 Madame Pussy Encyclopedia ：Deluxe Edition Reiko Mizuhara

  • amateur uncensoredpacopacomama
    • 2021-03-05
    87 min

    300MAAN-630 [H-cup god body healing nurse takes down NTR brush] At the request of her boyfriend, while taking off her skin to a man who does not like it, the small devil mode is activated! !! Munyumunyu milk pressure fucking explodes to play with de

  • amateur censoredcreampiebig titsmaanmaan-630maan630300maan-630
    • 2021-03-15
    72 min

    FC2PPV 1721361 [Individual] Slender intellectual beautiful wife, intelligent tax accountant, 50 years old, accident-level screaming crying Gonzo with pleasure to break [First special price]

  • amateur uncensoredfc2
    • 2021-03-18
    119 min

    [OKSN-322]New Discovery! Dirty Big Titty Adulterous Sex Steamy Sex With Insatiable Married Woman Who Wants To Be Completely Dominated

  • censoredbig titsOKSNabc mousouzokuokaasan.com abc daydream familyOKSN-322OKSN322oksn00322
    • 2021-03-18
    56 min

    [SIROR-054]The Work Of A Mature Woman For Rent - The Secret Side Of A Wife That Her Husband Will Never See - FILE NO.54

  • censoredcreampiebig titsSIRORdispatched.comSIROR-054SIROR054h-1492siror00054
    • 2021-03-19
    44 min

    FC2PPV 1727574 [No x uniform] Creampie sex with uniforms from the morning! (NO.006 Naughty-chan / Overtime) "Personal shooting / Gonzo"

  • amateur uncensoredfc2
    • 2021-03-23
    58 min

    SIRO-4466 [First shot] [Big breasts girl with hard work] [Swaying by the window ..] Growing up! The breast at the level protruding from the bra shakes violently. A busty girl who is doing a hard job is also on the bed .. AV application on the net → A

  • amateur censoredbig titsamateursirosiro-4466siro4466siro-4466
    • 2021-03-26
    120 min

    [WAAA-048]Woman Becomes A Public Facility Where Men Line Up To Fuck Her Raw Slut Takes 20 Loads From Older Men Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampieWAAAones factorywanzWAAA-048WAAA048waaa00048
    • 2021-04-01
    141 min

    [ID-030](Beloved Escort) I Ordered An Escort Who Normally Works As A C***dcare Worker (Cute) Momo Watanabe Momoka Watanabe

  • ruri kuribayashi ayaka tomoda censoredcosplayIDplumposter rawgunzshirouto only plumID-030ID0305521id00030
    • 2021-04-10
    62 min

    SIRO-4451 [First shot] [Golden egg aiming for the entertainment world] [Beautiful ass plump back] A beautiful carnivorous gal aiming for the entertainment world participates in the war. Release the erotic potential hidden in the small body to the ful

  • amateur censoredamateursirosiro-4451siro4451siro-4451
    • 2021-04-13
    48 min

    H4610 ki210413 Shion Iwaki 21years old

  • amateur uncensoredh4610
    • 2021-04-13
    116 min

    [STARS-360](Get Your Nookie On In Overwhelming 4K Video!) Her True Nature: A Neo Slut Kaede Hiiragi This Predatory Beautiful Girl Will Use Both Her Holes To Devour Maso Men's Cocks! Listen To Her Suck And Slurp While Giving A Blowjob And Get Men

  • hiiragi kaede censoredbeautiful girlsingle workSTARSsod createdragon nishikawasod starSTARS-360STARS3601stars00360
    • 2021-05-07
    129 min

    [HODV-21571]Reverse NTR "Hey Boss ... Do You Want To Rest Up At My Place？" This Boss Got Taken Home By His Employee And Taken For A Ride. Marina Saito

  • saitou marina censoredcreampiesoloworkHODVh m pryo inugamiHODV-21571HODV21571
    • 2021-05-22
    242 min

    [XRL-008]Nympho Slut Deep Kissing And Raunchy Cock Sucking BEST

  • aki sasaki an sasakura censoreduniformblowjobXRLreal worksreal real worksXRL-008XRL008xrl00008
    • 2021-05-24
    47 min

    FC2PPV 1834656 [Personal shooting, vaginal cum shot, pt off for a limited time] 33-year-old child and wife, who should have rubber, could not stand being rubbed with raw cock and accepted raw insertion …

  • amateur uncensoredfc2
    • 2021-05-28
    102 min

    [YST-246]This Sexually Frustrated Married Woman That I Became Friends With At A Remote Party Turned Out To Be A Pervert Who Wanted Dick

  • ichijo mio naoko akase censoredblowjobYSTkomyoYST-246YST246540yst00246
    • 2021-06-11
    48 min

    FC2PPV 1863160 Limited time offer [Individual shooting] Prefectural general course ① Freshmen. She is a curious girl who dedicates her first experience to her uncle.

  • amateur uncensoredfc2
    • 2021-06-11
    205 min

    [MIDE-935]Real Life Big Titty Gravure Idol Shows Off 4 Of Her First Time Orgasming Sex Experiences Ru Yumemi

  • dream censoredbig titsbeautiful girlMIDEmoodyzhiromichi hosemoodyz divaMIDE-935MIDE935mide00935
    • 2021-06-17
    218 min

    [SORA-317]A Heroine Never Gives Up, Even When She Loses Sarina Kurokawa

  • sarina kurokawa censoredblowjobslutSORAyama to soratelephone poleSORA-317SORA317sora00317
    • 2021-06-23
    121 min

    [MSA-020](Amateur) (Creampie) For 201 Days Only 20-Year-Old With Incredible Tits. Her First Gonzo Experience A Huge Amount Of Cum Shot Into Her Pussy! Dripping With Juice While Cuckolding My Boyfriend!

  • amateur censoredcreampieuniformMSAfutureMSA-020MSA020
    • 2021-06-26
    79 min

    [DANDAN-002]She Can Never Say No! Nurse With H-Cup Tits Devotedly Services Her Patients With Titty Fucking Miss Aimi

  • censoredbig titsblowjobDANDANdandytanaka baconDANDAN-002DANDAN0021dandan00002
    • 2021-07-09
    57 min

    FC2PPV 1912580 ★ 1,280pt until 7/25 (Sun) for a limited time !! [No / piece] Lost virginity last year？ !! Spilling huge breasts ♪ Defeat the neat and clean Kansai dialect cook (22) who has a boyfriend in the bath & bed! !! !! * High-quality review

  • amateur uncensoredfc2
    • 2021-08-18
    98 min

    [ZOZO-073]A Physical Examination From The Immoral Health Care Provider Who Goes After High S*********ls - The Rei Edition -

  • censoredcreampieZOZOsadie willenauZOZO-073ZOZO0731zozo00073
    • 2021-08-20
    240 min

    [MGDN-158]When The Married Woman, Who Is An Insurance Salesperson, Proposes To Trade Filthy Sexual Favors... 240 Minutes

  • censoredmilfstepmomMGDNstar paradisemegadonMGDN-158MGDN158h-254mgdn00158
    • 2021-09-09
    127 min

    [GUN-860]I Only Love Long, Thin Legs Now! Misuzu Kawana

  • misuzu kawana censoredsingle workGUNradixmg yukkybatsugunGUN-860GUN860433gun00860
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-11
    240 min

    [NASH-567]"Forgive Me For This" Crazed And Lustful After Being Made To Cheat

  • aoi mizutani hitomi honjo censoredbig titsmarried womanNASHpinknadeshikoNASH-567NASH567nash00567
    • 2021-10-05
    57 min

    230OREC-892 Rino (Anri Namiki)

  • amateur censoredcreampiebig titsorecorec-892orec892230orec-892
    • 2021-10-11
    51 min

    [SHH-027]Full Service Blushing Sluts: A Ranch Keeper With A Round, Peachy Ass

  • censoredsquirtingbeautiful girlSHHnatural highitaka smithlin powderSHH-027SHH0271shh00027
    • 2021-11-26
    42 min

    FC2PPV 2466389 [Uncensored] Genuine Friend ② I Asked Her To Take A Picture With An Erotic Female Friend … Which Is Better, Embarrassment Or Comfort？ Akemi (23 Years Old) & Shinobu (24 Years Old)

  • amateur uncensoredfc2
    • 2021-12-01
    120 min

    [AMBI-144]I Want To Do It With You!! Sexy Little Sister-In-Law Continues To Provoke Brother-In-Law Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlAMBIplanet plusbito sakuraanbibaresotsuAMBI-144AMBI144h-237ambi00144
    • 2021-12-03
    114 min

    [ADN-358]Ravaged In Front of Husband - Reunion Is The Start Of Doom!!! Reira Kuon

  • leira haduki censoredsingle workdramaADNattackerskazumaotona no dramaADN-358ADN358adn00358
    • 2021-12-03
    158 min

    [JUNY-053]Discovered A Plain Colleague Is A Call Girl...When Undresssed She Is Care Nurse With Huge Tits Ready For Raw Fuck Implantation Breaking In. Wareo Fujisawa

  • reo fujisawa censoredcreampiebig titsJUNYfitchnikuyokuJUNY-053JUNY053juny00053
    • 2021-12-03
    120 min

    [MIAA-534]While My Wife Was Away For 3 Days, I Pounced On My Voluptuous, Big Tits Stepdaughter, Who Had Ripened Nicely Into A Luscious JD, And Got Her Hooked On Sex And Squirting, And Converted Her Into My Own Personal Cum Bucket Ichika Seta

  • kazuhana seta censoredcreampiebig titsMIAAmoody strendy yamaguchieveryone s kikatanMIAA-534MIAA534miaa00534
    • 2022-01-06
    87 min

    [ETQR-332][Daydream POV] Nonstop Nipple Play Action! Beautiful Slutty Y********l Visits Man"s Homes To Give Him A Refreshing Massage Reona Tomiyasu

  • takehiro tomiyasu censoredcreampieuniformETQRerotic timeETQR-332ETQR332etqr00332
    • 2022-01-08
    61 min

    SIRO-4757 [First Shot] [Tall Stature] [Saddle Tide Leak] An Apparel Clerk With Beautiful Legs In A 170 Cm Model Body Has Appeared. Wet The Horny Part With A Word Blame, And When The Peach Butt Is Violently Stabbed With A Strong Root, Her Thighs Shake

  • amateur censoredamateursirosiro-4757siro4757siro-4757
    • 2022-01-10
    240 min

    [016HEZ-370]淫乱母娘ナンパ やっぱり親子！恥らいイキまくり！！4時間SP 4

  • amateur censoredcreampieamateurhezhez-370hez370016hez-370
    • 2022-01-26
    17 min

    [012622-001][VR] Pussy Encyclopedia: Rena

  • rena uncensoredcaribbeancom
    • 2022-02-01
    67 min

    200GANA-2623 In The Spear Room Of The Nampa Master Of Hyakusen Renma, Bringing Sex Hidden Camera 234 Waking Up And Saffle Sleeping Next To Muramura … Attacking Waking Up And Opening Libido! Estimated F Cup Boobs Shine Even Though It Is Thin! The

  • amateur censoredbig titsamateurganagana-2623gana2623200gana-2623
    • 2022-02-03
    51 min

    C0930 ki220203 Yoshiko Yamauchi 30years old

  • amateur uncensoredc0930
    • 2022-02-10
    136 min

    [BNST-041]My Wonderfully Obedient Fuck Toy! Arisu (Age 24) Arisu Otsu

  • otsu alice censoredbig titsBNSTteacher delusion groupsamuraiBNST-041BNST041bnst00041
    • 2022-02-18
    48 min

    230OREC-1019 Momo-Chan (Fukuda Momo)

  • amateur censoredamateurbeautiful girlorecorec-1019orec1019230orec-1019
    • 2022-03-01
    58 min

    Pacopacomama 022922_613 Mature Woman In Her 50s As It Is Done Miyuki Kaneda

  • amateur uncensoredpacopacomama
    • 2022-03-05
    240 min

    [SCR-291]Rough Sex With A Teacher That Gives A S*****t A Lewd Creampie On Camera, 4 Hours.

  • censoredcreampieschoolgirlSCRglay 039 zs crimeSCR-291SCR29112scr00291
    • 2022-03-18
    58 min

    417SRYA-024 <Geki Rare Butt Sp> The Strongest Bitch Wife Born From The Magical Cave Word Called Neighborhood Appears! !! ⇒ Tension Age Age ↑↑ Anyone Sex! Sex Everywhere! For The Time Being, What Is A Blow Job Suddenly At The Sex Garbage Dump W ⇒

  • amateur censoredcreampiebig titssryasrya-024srya024417srya-024
    • 2022-03-24
    116 min

    JRZE-107 A Document Of The First Time Shots Of A Seventy-Something Wife. Chiyoko Kawabata

  • kawahata chiyoko censoredcreampiesingle workJRZEcenter villageminatoyajurakuJRZE-107JRZE107h-086jrze00107
    • 2012-01-22
    99 min

    MCC-003 Confessions of a Newlywed Creampie ( Yuu Hasegawa )

  • censoredcreampiemarried womanMCCtoyohikogaara gaaraMCC-003MCC003mcc00003
    • 2022-04-01
    190 min

    JBD-282 The Guy I Loved Was A Devil...

  • asai akari shinmura censoredlesbianbdsmJBDattackersthin blade purplesnakeJBD-282JBD282jbd00282
    • 2022-04-08
    231 min

    SKMJ-274 Happy Endings Are Against The Rules At This Men"s Massage Parlor, But After 3 Months This Gorgeous Slut Is Willing To Make Exceptions For Loyal Customers - Her Secret Raw Creampie Sex Options Filmed On Hidden Cameras 3

  • censoredcreampieamateurSKMJblush girlSKMJ-274SKMJ274h-1324skmj00274
    • 2022-04-08
    62 min

    FC2PPV 2784733 [Uncensored] Similar To Sasaki! A Beautiful And De S Receptionist. A Teasing Play That Is Stopped At A Woman On Top Posture That Is Too Fierce That Shakes Handjob And Big Tits. A Pitiful Ochinpo Can Not Stand It And Mass Ejaculates

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored