mitsuki kamiya




FC2DTTMVSDVENXNGODNACXDASDRBDNATRSSISSANHDKAFSDSSAVSAGMEMCAWDONEZAPODABWEBODAUKS

2020-11-16
79 min

259LUXU-1331 Luxury TV 1327 Former race queen beautiful mature woman with a lustrous glamorous body makes her first AV appearance! Sprinkle the sex appeal that can not be hidden, and the storm of cum on intense sex after a long absence! Shake big tit

  • amateur censoredbig titsamateurluxuluxu-1331luxu1331259luxu-1331
    • 2020-12-05
    236 min

    [TSP-436]Corrupted By Pleasure Before She Knew It. Horny College Professor "Teacher, My Pussy Is Throbbing..."

  • censoredcreampieTSPtokyo specialmanji groupTSP-436TSP436tsp00436
    • 2020-12-06
    163 min

    [DNJR-039]Naughty Barely Legal Beautiful Girl Tempts Guys With Her Panties Mirei Nitta

  • mirei nitta censoredbeautiful girlslutDNJRdog delusion groupmaboroshikoDNJR-039DNJR039dnjr00039
    • 2020-12-17
    50 min

    285ENDX-320 Be careful of the volume! The gap between conversation and pant voice is amazing! E-cup female college student who is seriously spree when Iku while laughing shyly

  • amateur censoredcreampiebig titsendxendx-320endx320285endx-320
    • 2020-12-25
    48 min

    480FRIN-013 《Personal shooting / Hidden shooting》 The selection video of the weather girl audition pillow business leaked

  • amateur censoredanalamateurfrinfrin-013frin013480frin-013
    • 2020-12-26
    61 min

    1Pondo 122620_001 Model Collection: Non Suzumiya

  • amateur uncensored1pondo
    • 2020-12-26
    61 min

    HEYZO 2424 Deep Kiss, Furious Sex -Smitten With Kiss- – Reika Kudo

  • reika kudo uncensoredcreampiecumshotheyzo
    • 2020-12-27
    56 min

    [oretd-825]Tsumugi

  • amateur censoredcreampieuniformoretdoretd-825oretd825oretd-825
    • 2021-01-04
    151 min

    [C-2609]Married Woman Stolen Away, A Steamy Vacation 23

  • censoredCgogosgogo s coreC-2609C2609140c02609
    • 2021-01-08
    79 min

    300NTK-497 Convulsions Sensitive Prickets Beautiful Girl Get Drunk Continuous Ascension! !! If you get drunk with a geki piss and hit Nuru Kanzake, you will feel the pressure in the vagina as it shakes. !! The more I drink sake, the more Ichacola SEX

  • amateur censoredcreampieamateurntkntk-497ntk497300ntk-497
    • 2021-01-29
    200 min

    [ABW-051]Aesthetics Of A Facial 13 - Creamy Cum Dripping From The Faces Of Hot Babes! Rumina Yuki

  • yuki rumina censoredcosplaysingle workABWprestigeshimikkiabsolutely wonderfulABW-051ABW051118abw00051
    • 2021-01-29
    306 min

    [KNMD-100]夫に先立たれ疼く身体を抑えられない未亡人 5時間

  • shota chisato kaoru kimishima censoredmature womanKNMDkinema zamanjirouKNMD-100KNMD100h-1352knmd00100
    • 2021-01-31
    33 min

    493PKPD-081 [Leaked] Nasty OL personal shooting! Last vaginal cum shot before enrollment

  • amateur censoredamateurbeautiful girlpkpdpkpd-081pkpd081493pkpd-081
    • 2021-02-04
    46 min

    FC2PPV 1672408 [First shot, super rare! ] Small animal young wife is cheating for the first time ♥♥ A state of absentmindedness to a cock larger than imagined.

  • amateur uncensoredfc2
    • 2021-02-04
    94 min

    [AKDL-083](For Guys Who Want Girls To Step On Their Faces) All POV! Extreme Smells! Teased By Foot Sole Fragrances

  • kohara kihara ami kirishima censoredAKDLaquinorishrikenaknrAKDL-083AKDL0831akdl00083
    • 2021-02-19
    84 min

    383REIW-048 Yuki

  • amateur censoredcreampieamateurreiwreiw-048reiw048383reiw-048
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-26
    120 min

    [NEM-057]Genuine Abnormal Sex A Fifty-Something Stepmom And Her Stepson Chapter Twenty-Three A Stepmother Who Allows Her Stepson To Suck Her Titties Ryo Fukutomi

  • ryo fukutomi censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-057NEM057143nem00057
    • 2021-03-06
    118 min

    [ADN-302]"Hey... We Can Still Do It, Right？" Nailing Your Gorgeous, Dedicated Boss From Dusk Until Dawn. Tsumugi Akari

  • akari tsumugi censoredslutsingle workADNattackerskazumaotona no dramaADN-302ADN302adn00302
    • 2021-03-11
    149 min

    [HAWA-241]I Let This Runaway Housewife Stay At My Place, So We Spent Our Days Creampie Fucking From Morning Until Night Mao Is A Creampie Specialty Obedient Runaway Wife 24 Years Old

  • censoredcreampieHAWAcosmos eizohidemonkcosmospictures soft on demandHAWA-241HAWA2411hawa00241
    • 2021-03-16
    144 min

    [MXGS-1176]A Blatantly Cute Little Devil Of A Slut Narumi Hirose

  • narumi hirose censoredbeautiful girlsingle workMXGSmaxingMXGS-1176MXGS1176h-068mxgs01176
    • 2021-03-27
    56 min

    230OREX-212 Ayase (H Cup)

  • amateur censoredcreampiebig titsorexorex-212orex212230orex-212
    • 2021-04-08
    53 min

    FC2PPV 1760262 [Individual shooting appearance] No63 Yuna-chan 18 years old J system graduation commemoration! A virgin with zero male experience can not stand the toys and ejects a lot

  • amateur uncensoredfc2
    • 2021-04-23
    16 min

    FC2PPV 1761264 [Fu ○ Fire Dance] Hyottoko Sucking Vacuum Blow Without Erokos Big Breasts Older Sister

  • amateur uncensoredfc2
    • 2021-05-06
    19 min

    HEYZO 2516 A Titty Fuck with Rena – Rena Sanka

  • rena sanka uncensoredblowjobcumshotheyzo
    • 2021-05-14
    140 min

    [SKMJ-167]Limber Big Booty Instructor Takes A Quickie! She Gets So Horny In The Middle Of A Lesson That Her Panties Are Soaked! Her Super Sensitive Body Is On Fire To Fuck, And She Cums Over And Over! Finally The Two Of Them Awaken This Slut To Absol

  • censoredbig titsSKMJred face girlswing nagaseSKMJ-167SKMJ167h-1324skmj00167
    • 2021-05-21
    57 min

    230OREC-774 Mai

  • amateur censoredcreampieamateurorecorec-774orec774230orec-774
    • 2021-05-21
    44 min

    494SIKA-081 [For enthusiasts] Gonzo 3P of pregnant bitch

  • amateur censoredcreampieschoolgirlsikasika-081sika081494sika-081
    • 2021-05-24
    99 min

    300MIUM-708 Big Breasts H Cup! Abnormal lust wife who seeks more than 3 times 365 days! !! !! → [My husband is a stocking fetish. His wife is wearing no pantyhose even on the go. A nasty smell stood up …! ] X [Leotard and Pichi Pichi’s pie

  • amateur censoredcreampiebig titsmiummium-708mium708300mium-708
    • 2021-05-24
    20 min

    FC2PPV 1833619 Naked and charmed with a full-length no-hand blow job! The strongest fetish of the cute and small devil long tongue, God Tech Airi-chan! A large amount of semen is fired in the mouth and muddy reverse to the dick w

  • amateur uncensoredfc2
    • 2021-05-28
    121 min

    [WAAA-065]Shooting Cum Inside Of Her After She's Already Orgasmed! Moa Maeda

  • maeda momoko censoredcreampiebig titsWAAAwanz factorywanzWAAA-065WAAA065waaa00065
    • 2021-06-01
    240 min

    [DKSB-121]Super Close-Up Angles Of Amateur Girls Enjoying Vaginal Masturbation A 4-Hour Collection

  • censoredamateurDKSBoffice k sk s bestDKSB-121DKSB12136dksb00121
    • 2021-06-11
    76 min

    [HYPN-044]Influenced And Dominated Stepmom: Turning My Father's New Wife Into An Obedient Sex Servant - Akane Soma

  • soma censoredcreampiemarried womanHYPNsod createsatoshi morikawamind controlHYPN-044HYPN0441hypn00044
    • 2021-06-15
    64 min

    FC2PPV 1869705 [No] [High-quality review privilege] Until the essence is exhausted ♡ One-on-one 1-hour endurance vaginal cum shot SEX game‼ Break through the limit of 6 consecutive shots! ‼ ‼

  • amateur uncensoredfc2
    • 2021-06-20
    126 min

    [CEMD-024]Screaming! Fainting! Working That G-Spot! Coming So Far Into Hana Shirato That It Reaches The Back Of Her Womb

  • white peach censoredmature womanbeautiful girlCEMDceleb no tomoCEMD-024CEMD024cemd00024
    • 2021-07-13
    68 min

    OTAT-005 Mizuki-san

  • amateur censoredamateurblowjobotatotat-005otat005otat-005
    • 2021-07-17
    120 min

    [DASD-894]My Girlfriend And I Got Hired By The Same Company After Graduation, And Now Our Boss Is Breeding Her. Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-894DASD894dasd00894
    • 2021-07-27
    120 min

    [SAN-011]I Let My Manager With The Big Dick Fuck Me At My Part Time Job -Shion Nagisawa

  • nagisawa shion censoredcreampiebig titsSANmothermother motherSAN-011SAN011h-796san00011
    • 2021-07-29
    121 min

    [TOEN-046]Sexually Frustrated Stepmom Becomes Addicted To Sex With Her Stud Stepson During The Three Days Her Husband Is Out Of The House And They Fuck Day And Night For 72 Hours Straight Tsubaki Kato

  • kato camellia censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-046TOEN046h-086toen00046
    • 2021-08-06
    135 min

    [MEYD-691]Commemorating 15 Years With Goro Tameike Collaboration No.7 An Unusual Full Option Creampie Adultery Fuck Fest With A Soapland Princess Lover Who Has No Boundaries Hitomi

  • hitomi censoredcreampiebig titsMEYDtameike goroshouten shirouMEYD-691MEYD691meyd00691
    • 2021-09-04
    156 min

    [LULU-090]Getting Fucked By My Son"s Friend Over And Over All Day Yukino Nagisa

  • yukino nagi censoredcreampiebig titsLULUlunaticsruminakkusuLULU-090LULU090lulu00090
    • 2021-09-10
    152 min

    [SSIS-179]When Our Little Stepbrother Was Transformed Into A Slender And Beautiful Y********l, We Were Plagued With Feelings Of Conflict, But In The End, We Succumbed To Our Lust And Fucked His Brains Out. Hikari Tamaki

  • wachi subaru censoredbig titsbeautiful girlSSISs1 no 1 stylekyouseiSSIS-179SSIS179ssis00179
    • 2021-09-20
    118 min

    [OFKU-189]The Stepmother, Who Has A Big Ass, Came To Tokyo From Morioka...Shihori Akiyama, 40 Years Old

  • akiyama shiori censoredcreampiemomOFKUstar paradiseofukuro tetsudouOFKU-189OFKU189h-254ofku00189
    • 2021-09-24
    95 min

    [VENX-075]"Hey... Why Are You Twitching So Hard There" Expert Slut Reverse Pick Up. Sudden Male Squirting. Yu Shinoda , Hibiki Otsuki

  • kujo michiru censoredcreampiemature womanVENXvenuspe taincest vi nasuVENX-075VENX075venx00075
    • 2021-10-01
    160 min

    [CAWD-288]A Sweetly Sadistic Beautiful Y********l In Uniform Who Loves B.B. Boys Incessantly And Will Shut Down Your Reasonable Mind Through Nipple Teasing Yumeru Kotoishi

  • yume kotoishi censoreduniformslutCAWDkawaiikc takedaCAWD-288CAWD288cawd00288
    • 2021-10-11
    115 min

    503KOO-023 Mayu (Mayumi Komikawa)

  • amateur censoredbig titsamateurkookoo-023koo023503koo-023
    • 2021-10-30
    141 min

    [MMKS-017]Naughty Service. A Soothing Big-Assed Soapland Girl. Ichika Matsumoto

  • ichika matsumoto censoredbeautiful girlsingle workMMKSmarrionmiyamoto kojirouirisMMKS-017MMKS017mmks00017
    • 2021-11-15
    105 min

    420MGMR-135 IZAYOI (26) Amateur Hoi Hoi, Saffle, Beauty, Literature, Gap, 2 Shots, Neat, Black Hair, Beautiful Girl, Facial Cumshot, Gonzo

  • amateur censoredamateurbeautiful girlmgmrmgmr-135mgmr135420mgmr-135
    • 2021-11-19
    119 min

    [SSIS-241]Forbidden Teacher Love. Yua Mikami

  • yua mikami censoredbig titsslutSSISs1 no 1 stylekyoseiSSIS-241SSIS241ssis00241
    • 2021-11-26
    62 min

    300NTK-664 [Yodare Beauty Big Tits] [Beauty Complete Awakening] [Disturbance Gonzo 2nn] The Mouth On Kimatte Is Also Drooling And The Mouth Underneath Is Really Wet! !! Beautiful Big Breasts Swaying And Swaying De Nasty Nature Release Whitening Mochi

  • amateur censoredcreampiesquirtingntkntk-664ntk664300ntk-664
    • 2021-12-09
    181 min

    [DLDSS-042]100発ザーメン搾り獲るまで出られない家からの脱出 友田彩也香

  • ayaka tomoda censoredcreampiesingle workDLDSSdahliayamaguchi memberDLDSS-042DLDSS0421dldss00042
    • 2021-12-15
    28 min

    FC2PPV 2518531 A Slender Gal Of A Tekiya. "Put In" And Begging For "Ikuiku" Barrage And Vaginal Cum Shot * Limited To 100 Year-End Specials

  • amateur uncensoredfc2
    • 2022-01-08
    68 min

    C0930 tk0050 Hisako Niu 28years old

  • amateur uncensoredc0930
    • 2022-01-28
    161 min

    [BF-656]My Big Tittied Plain Looking Neighbor Uses Me To Satisfy Her Sexual Frustration, Starring Rino Yuki

  • yuki rino censoredbig titsblowjobBFbefreeroku yonBF-656BF656bf00656
    • 2022-02-04
    145 min

    [SSIS-323]Crazy Room Sharing Scenario Where It"s Impossible To Refuse This Lustful Boss During A Business Trip... This Fresh Face Weather Forecaster Didn"t Expect To Be Lost In Sex And Adultery That Goes All Night Long Till Morning. Mian Shir

  • mian shirasaka censoredsingle workSSISs1 no 1 styleamazing meatSSIS-323SSIS323ssis00323
    • 2022-02-05
    35 min

    230OREC-1010 Miwa-Chan (Miwa Susaki)

  • amateur censoredcreampieamateurorecorec-1010orec1010230orec-1010



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored