naka p




FC2SPRDHNDNACRMEYDVEMACHRVPPPDSQTEHODVADNBLKMIAAVENXRBDKSBJAUKSNNPJHDKAMILKVENU

2020-10-03
116 min

[SSPD-164]My C***dhood Friend Became My Big Sister-In-Law, And When I Saw Her Prancing Around The House Scantily Clad, I Could No Longer Bear It, And Decided To Cross That Line. Kana Yume

  • kana yui censoredsquirtingsingle workSSPDattackerskitorune kawaguchisuper specialSSPD-164SSPD164sspd00164
    • 2020-10-10
    231 min

    [HJMO-441]Best Friends Face Off! Fixed Dildo Hip Grinding Contest, They Can't Go Home Until They Grind 1000 Times!! 8

  • censoredbig titssquirtingHJMOhajime kikakuhajimeHJMO-441HJMO441hjmo00441
    • 2020-10-25
    182 min

    [HPOW-004]Parents Will Cry With Shame After Watching This Video Vol.4 Loving And Lovestruck Sex With A Short Busty S********l An Amateur Girl With The Power To Attract Men / Teenage / A Beautiful Girl / Lovey-Dovey Sex / School Uniform / Clothed Sex

  • censoredbig titsschoolgirlHPOWamateur seduction daydream familyHPOW-004HPOW004hpow00004
    • 2020-11-20
    114 min

    [MBDD-2047]Sayaka Miki/Butt Naked Mode

  • sayaka miki censoredbeautiful girlMBDDmedia brandhideo shimomurasekiraraMBDD-2047MBDD2047301mbdd02047
    • 2020-11-24
    142 min

    [SDMM-078]One-Way Mirror Cab - Nurses Only! "Would You Give A Massive Cock A Medical Examination？" Angels In White Soothe Guys With Dick Trouble Every Way They Know How 2

  • censoredamateurhandjobSDMMsod createanzomagic mirrorSDMM-078SDMM0781sdmm00078
    • 2020-11-27
    241 min

    [MKMP-366]million 歴代最高の美巨乳34名と濃厚SEX4時間BEST！！！

  • maria nagai suzuki mayu censoredcreampiebig titsMKMPk m producek taroumillionMKMP-366MKMP36684mkmp00366
    • 2020-12-05
    55 min

    H4610 ki201206 Rina Tachikawa 26years old

  • amateur uncensoredh4610
    • 2020-12-17
    119 min

    [SSNI-942]My Buddy's Girlfriend Is Blind Without Her Glasses - I Tricked Her Into Fucking Me Yura Kano

  • yura kanno censoredsingle workdramaSSNIs1 no 1 stylemametaro mamezawaSSNI-942SSNI942ssni00942
    • 2020-12-18
    127 min

    [NCYF-008]Real 6-Some Orgy! The Most Pouty, Prickly Cosplayer With A Secret Soft Side This Club Has Ever Seen "Please, I Want It Deeper" - Screaming Orgasms, Endless Sex (10 Squirting, Furious Orgasms) (Every Guy There Breeds Her With His Cum

  • censoredcreampiesquirtingNCYFall japan kameko cooperative delusional groupudagawaall japan kameko cooperative mousouzokuNCYF-008NCYF008ncyf00008
    • 2020-12-18
    240 min

    [MBM-247]My Stepson's Johnson Was So Big... She's Hit The Peak Of Her Lust! Unstoppable Forbidden Passions A Fully Ripe MILF Has Sex Like A Horny Slut 12 Ladies 4 Hours

  • censoredmarried womanmature womanMBMprestigesasazuka garoumbmMBM-247MBM247118mbm00247
    • 2021-01-09
    119 min

    [EBOD-794]Swapping Stepsisters - "I'll Let You Grope My Stepsister's Big Tits If You Do The Same For Me!" - 2 Girls And 2 Guys Fuck Like Monkeys In The Summer Countryside - Yukino Nagisa, Ruka Inaba

  • yukino nagi inaba censoredcreampiebig titsEBODe bodyxavier thomas 2EBOD-794EBOD794ebod00794
    • 2021-01-12
    61 min

    FC2PPV 1642324 Outstanding style M-chan ♀ G-spot intensive development “Do you like this？” Muzzle “Ah” Ah … I like it I like it /// “The vaginal wall is accurately stimulated with my fingers and a meat stick …

  • amateur uncensoredfc2
    • 2021-01-24
    81 min

    345SIMM-595 Super innocent idol face J ○ rushes into the family-less toilet in search of Ochi ○ Po! Erotic videos are blackmailed (laughs) by a horny slut who loves sex very much, and hotein → camera soaked laser tide is shot! The inside, mouth, and

  • amateur censoredcreampiesquirtingsimmsimm-595simm595345simm-595
    • 2021-01-26
    59 min

    HEYZO 2447 Gravid Teacher Is Dying To Have Sex! – Nanako Asahina

  • nanako asahina uncensoredcreampieheyzo
    • 2021-02-12
    119 min

    [IPX-615]Polite Dirty Talk - Massage Parlor Slut Sweetly Teases You With Her Lingerie - You Can't Leave Until You Cum Tsubasa Amami

  • amami tsubasa censoredcreampieslutIPXidea pocketzaku araidishIPX-615IPX615ipx00615
    • 2021-02-12
    35 min

    S-Cute 828_miruka_01 SEX with uniform daughter as it is done / Miruka

  • miruka censoredschoolgirlamateurmirukamiruka-01miruka01828-miruka-01
    • 2021-02-13
    61 min

    FC2PPV 1684482 ★ First shot amateur wife ☆ Pocha Lori busty big ass young wife Marimo 23 years old ☆ Even though she is newly married, she is disturbed by another stick ♥ De nasty blowjob ♥ I made a lot of vaginal cum shot in a sensitive pussy! [Pers

  • amateur uncensoredfc2
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-26
    170 min

    [GYAN-012]"Excited By The Thrill Of Getting Caught" Sluts In Swimsuits Fucking In The Open Air - Sex In A Seaside Tent Yuka Hoshi

  • yuka hoshi censoredsingle workGYANprestigehimurokkugyan prestigeGYAN-012GYAN012118gyan00012
    • 2021-03-06
    180 min

    [PRED-294]Sweaty, Orgasmic Sex So Good, You'll Lose Your Mind And Start Shaking Your Ass And Cumming Like A Sexual Beast 9000cc Of Sweat And Bodily Fluids 5100 Orgasms 30000cc Of Squirts Yuki Takeuchi

  • yuki takeuchi censoredcreampiesquirtingPREDpremiummametaro mamezawaelegancePRED-294PRED294pred00294
    • 2021-03-12
    67 min

    438PVMB-012 Himari

  • amateur censoredamateurcosplaypvmbpvmb-012pvmb012438pvmb-012
    • 2021-03-16
    93 min

    261ARA-482 [Super Miracle Beautiful Girl] 20 Years Old [Boyish with Shortcut] Suzu-chan Visits! The reason for her application to work part-time at a ramen shop is "I lost my curiosity ♪" AV appearance without telling my boyfriend! The desire

  • amateur censoredamateuraraara-482ara482261ara-482
    • 2021-03-17
    63 min

    SIRO-4421 [First shot] [Wheat-colored gal] [Piku Piku climax] A 22-year-old manicurist who looks like a half model. Her tan skin was tense and sweaty, and she was also a man’s technique .. Application amateur, first AV shooting 203

  • amateur censoredamateursirosiro-4421siro4421siro-4421
    • 2021-03-22
    201 min

    [KATU-080]Getting Jerked Off By Beautiful Smooth Thighs 5 Sluts In Miniskirts With Plump Bodies!

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-080KATU080katu00080
    • 2021-03-26
    73 min

    230OREX-208 Ruka-san

  • amateur censoredcreampiebig titsorexorex-208orex208230orex-208
    • 2021-04-01
    47 min

    H4610 ki210401 Yumika Maijima 25years old

  • amateur uncensoredh4610
    • 2021-04-01
    63 min

    SIRO-4459 [First shot] [Fluffy natural boobs] [Sorry for all the fans] G milk beauty who sprinkles another dimension of beauty participates in the war! A gravure idol whose first experience in life is shot with a camera .. AV application on the net →

  • amateur censoredamateursirosiro-4459siro4459siro-4459
    • 2021-04-17
    118 min

    [JUL-544]Sharing A Hotel Room Overnight On A Business Trip With The Female Supervisor I've Always Been In Love With Minori Hatsune

  • hatsune minori censoredmature womansingle workJULmadonnamametaro mamezawaJUL-544JUL544jul00544
    • 2021-04-24
    160 min

    [LULU-066]When Her Big Dick Stepson Had Become Withdrawn And Transformed Into "A C***dish Old Man" This Big Tits Stepmom Ended Up Becoming His Own Personal Glory Hole So That She Could Take Care Of His Sexual Needs Honami Akagi

  • honami akagi censoredcreampiebig titsLULUlunaticsluminaxLULU-066LULU066lulu00066
    • 2021-05-07
    160 min

    [SUN-014]Horny Housewives (Bunny) - She Can't Survive Without Cum - Exhibitionist Seduces Dicks At A Sex Shop And Swinger's Club

  • kazama yumi censoredbig titsmature womanSUNsunbacon tanakaSUN-014SUN01413sun00014
    • 2021-05-14
    53 min

    285ENDX-341 Beautiful Legs Female College Student Aiming For A Tax Accountant! The head is good and the rate of Mutsurisukebe is high!

  • amateur censoredcreampieamateurendxendx-341endx341285endx-341
    • 2021-05-19
    29 min

    FC2PPV 1826742 Limited sale [First outflow] Idol group center-like beautiful girl called to the parking lot at the end of shooting and fornication in the car with the president’s son

  • amateur uncensoredfc2
    • 2021-05-29
    160 min

    [LULU-071]When He Could No Longer Resist The Temptation Of His Step Auntie's (A Former Bad Girl) Big Ass, He Transformed Into A Horny Sexual Monkey! He Grabbed Her Hips As He Pumped Her From Behind Until He Creampie Ejaculated His Entire Load Int

  • kiyoshi maihara censoredcreampiesingle workLULUlunaticsvagmanLULU-071LULU071lulu00071
    • 2021-06-15
    57 min

    481SACZ-035 Sachiyo 1

  • amateur censoredamateurmature womansaczsacz-035sacz035481sacz-035
    • 2021-06-17
    144 min

    [SINN-018](Swooning Orgasmic) Adultery! Cheerful Married Woman With A Thick Booty Corrupted By Creampie Sex "I Got Knocked Up By My Lover, So My Husband's Thrown Me Out..." A Record Of Cheating

  • censoredcreampieSINNshinsekai mousouzokuSINN-018SINN018sinn00018
    • 2021-07-09
    149 min

    [MIAA-467]Gyaru Who Wants Pocket Money Won't Stop Fucking Even When He Cums, An Incredible 10 Creampies Without Taking It Out Ranka

  • ranka censoredcreampieblowjobMIAAmoodyztakarase hironoriminna no kikatanMIAA-467MIAA467miaa00467
    • 2021-07-13
    114 min

    SMUK-050 Mitsuki

  • amateur censoredcreampieuniformsmuksmuk-050smuk050smuk-050
    • 2021-07-23
    60 min

    FC2PPV 1937641 * Limited Time 4980⇒2980pt ★ First Shot ☆ The Advent Of A Beautiful Girl! Beautiful Face ♥ Beautiful Breasts ♥ Beautiful Body Lara 20 Years Old ☆ Sensitive Nympho Pussy Rolls Up ♥ Agony In Raw Dick ♥ Continuous Cum Shot Inside The Vagi

  • amateur uncensoredfc2
    • 2021-08-01
    127 min

    [MARA-060]夕季ちとせの爆乳劇場 Jcup！110cm

  • chitose in the evening censoredcreampiebig titsMARAplanet plusdirector omarakasuMARA-060MARA060h-237mara00060
    • 2021-08-13
    191 min

    [ROYD-066]My C***dhood Friend And Little Stepsister Love Me So Much That They Fight Over Tempting And Fucking Me. Aoi Kururugi, Yuna Himekawa

  • aoi kururugi ran tsukishiro yuna himekawa censoredsisterROYDroyalkawajirihhh groupROYD-066ROYD066royd00066
    • 2021-09-02
    124 min

    [JRZE-074]First Time Filming My Affair, Yumika Towa

  • fujiwa yuka censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-074JRZE074h-086jrze00074
    • 2021-09-11
    52 min

    C0930 ki210911 Reiko Tokuda 58years old

  • amateur uncensoredc0930
    • 2021-09-11
    60 min

    H0930 tk0041 Chiho Tsuzuki 30years old

  • amateur uncensoredh0930
    • 2021-09-17
    119 min

    [MEYD-702]60 Days Abstinence Project! Restraint And Intense Orgasm! Her Patience Ran out And She Became Sexually Deranged While Restrained! Outrageous Male-hunting Lady SEX! Sakura Misaki

  • cape sakura censoredcreampieslutMEYDtameike gorokindaichishougo rouMEYD-702MEYD702meyd00702
    • 2021-09-17
    240 min

    [DVDMS-710]A Normal Boys And Girls Focus Group Adult Video We Invited A Middle-Aged Husband And Wife Who Get Along Great To A Room Specially Fitted With A 2-Way Mirror And Had Them Separate And Take On The Resistance Challenge Against The Amazing Ski

  • ichika matsumoto censoredcreampiemarried womanDVDMSdeepsfunky haseideep sDVDMS-710DVDMS710dvdms00710
    • 2021-09-23
    53 min

    FC2PPV 2240112 First Shot [Uncensored] Nanami Hashimoto / Three Close Contacts With Camp Girls. In A Narrow Vagina In Various Places During An Interview Outside In Her Room

  • amateur uncensoredfc2
    • 2021-10-05
    50 min

    FC2PPV 2300249 Roll Up The Virgin Cock That Teenage Girl Saya Loves! Virgin (Amateur Virgin) We Released A Brush Play With 5 People!

  • amateur uncensoredfc2
    • 2021-10-09
    238 min

    [NASH-586]A Married Woman Betrays Her Husband "Dear, Please Forgive Me, I Just Wanted Some Excitement" Best Hits Collection 4 Hours

  • censoredcreampiemature womanNASHnadeshikoNASH-586NASH586nash00586
    • 2021-10-23
    252 min

    [MDBK-203][Total POV x Big Tits] No. 1 Titty Lover Satisfaction, Intense Titty Play Highlights

  • kurata mao hasumi claire censoredbig titsMDBKbazookataro kMDBK-203MDBK203mdbk00203
    • 2021-11-06
    62 min

    355OPCYN-194 Misuzu 2 (Kashii Misuzu)

  • amateur censoredamateuropcynopcyn-194opcyn194355opcyn-194
    • 2021-11-13
    103 min

    [OMHD-012]Poison Gas/Extremely Orgasmic Persuasion Experiment via an Aphrodisiac. Hana Shirato

  • white peach censoreddeepthroatsingle workOMHDdogmaoota migiwaOMHD-012OMHD012omhd00012
    • 2021-11-13
    123 min

    [TIKB-125]Private One-on-One Photo Session: Big Tits, a Gal, a Big Ass, Creampie, and POV

  • mizukawa violet haruka nogi censoredcreampiebig titsTIKBchikichikiba gu mousozokuTIKB-125TIKB125tikb00125
    • 2021-12-05
    62 min

    FC2PPV 2487791 Until 12 2480 [No] A Beautiful Hostess. She Commits A Fair And Slender Body With Multiple People And Vaginal Cum Shot Without Permission.

  • amateur uncensoredfc2
    • 2021-12-07
    72 min

    FC2PPV 2497011 [Chinkomanko Great Battle! ] Challenge From Bitch! Yarisa ♀ Corps Vs Individual Shooting Gonzo’S Big Orgy Sp ★ Drinking Raw Squirrel Cum Shot Super Heaven ♥ Chinpo Addiction Height 170 Over Busty Beauty Miporin (24) [cen]

  • amateur uncensoredfc2
    • 2021-12-11
    155 min

    [MKMP-429]Although At Bottom of School Caste, I Had Dream Sex After School Being Sexually Processed By 3 Hotties In Class. Harem Classroom.

  • ichika matsumoto satoshi kuruki censoredcreampiebeautiful girlMKMPk m producerakudamillionMKMP-429MKMP429mkmp00429
    • 2021-12-17
    130 min

    [BLK-541]Until Morning, Suck Down As Much As You Want and Fuck as Much As You Want! Discovery of a Junior Mama-san at a Bar. She is a Slut with Totally Erotic Areolas. MIYABI

  • miyabi censoredcreampiebig titsBLKkira kirakira kira black galBLK-541BLK541blk00541



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored