nampa censored jav housewife javcensored




FC2EBODWAAACESDATIDCAWDMEYDDASDVEMAADNMILKCJODAVSASSISHZGDWANZHNDAUKSMIDVGMEMNATR

2020-09-11
73 min

[ore-701]ユサ

  • amateur censoredbig titsschoolgirloreore-701ore701ore-701
    • 2020-09-22
    53 min

    1Pondo 092220_001 Piledriver BJ, Special Edition 12: Kotomi Yamazaki Minami Sakamoto Satsukii Shibata

  • amateur uncensored1pondo
    • 2020-10-06
    140 min

    [SDAB-145]At The PtoM Academy, You'll Get Your Cock Rocked With A Cowgirl, And Then You'll Receive A Blowjob, And Then The Cycle Repeats, Over And Over Again Risa Shiroki

  • risa shirojo censoredschoolgirlblowjobSDABsod createsuisei akaione s youthSDAB-145SDAB1451sdab00145
    • 2020-10-09
    119 min

    [MDTM-673]Complete POV: Uniform Intercourse - Aoi Nakajo

  • nakagusuku censoredcreampieuniformMDTMuchu kikakutodoMDTM-673MDTM673h-585mdtm00673
    • 2020-10-17
    121 min

    [OKSN-304]Married Woman With Colossal Tits' Adultery Trip - I Want To Forget Everything And Fuck All Night Long...

  • censoredbig titsOKSNabc mousouzokuokasan.comOKSN-304OKSN304oksn00304
    • 2020-10-24
    44 min

    FC2PPV 1545858 [Personal shooting] A married woman who works at a local government office is back dirt! I can’t control my aching body and I’m captivated by other sticks! Unstoppable lust vaginal cum shot [appearance]

  • amateur uncensoredfc2
    • 2020-11-11
    59 min

    345SIMM-550 Harumi / 35 years old / H cup mature erotic brother-in-law

  • amateur censoredcreampiebig titssimmsimm-550simm550345simm-550
    • 2020-11-12
    93 min

    [OKP-071]A Divine Office Lady In Glasses Aoi Mizutani We're Bringing You An Office Lady In Glasses And Business Suits With Her Beautiful Legs Wrapped In Naughty And Nasty Pantyhose For Fully Clothed Musty Sniffing Pleasure, From Her Soles To Her

  • aoi mizutani censoredbukkakeOKPpersonal photography of fatherkoenji gorogod pantyhoseOKP-071OKP0711okp00071
    • 2020-11-14
    52 min

    FC2PPV 1569676 [Individual shooting] I got sick again with my sister’s friend! Get on the tone and put on bloomers and make a vaginal cum shot with clothes etch!

  • amateur uncensoredfc2
    • 2020-11-19
    243 min

    [KSBJ-107]Creampie Sex With 12 Married Women With Beautiful And Supply Bodies

  • aika erika censoredcreampieKSBJksb kikaku emmanuelleKSBJ-107KSBJ107ksbj00107
    • 2020-11-25
    58 min

    [orec-637]うたさん

  • amateur censoredamateurblowjoborecorec-637orec637orec-637
    • 2020-11-28
    119 min

    [MIAA-355]- Strong Beauty Who Fucks Her Husband's Superior - Even Though She Quit Her Job As Investigator To Get Married Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsMIAAmoodyzsuisei akaieveryone s porn starMIAA-355MIAA355miaa00355
    • 2020-12-27
    48 min

    FC2PPV 1622111 [Personal shooting] An obedient wife who works at Enko instead of her husband who lost his job! A married woman whose body is honest and disgusting but exposes her libido [Creampie]

  • amateur uncensoredfc2
    • 2020-12-31
    118 min

    [ATID-448]Secret Mid-Day Adultery Training She Can't Reveal To Her Husband: I Spotted A Beautiful Married Woman On The Street One Day, And A Few Days Later... Yui Hatano

  • yui hatano censoredsingle workATIDattackersnagira kenzoin madATID-448ATID448atid00448
    • 2021-01-01
    129 min

    [SY-194](New: Tiny Room) Now That This MILF's Got Two Young K*ds Of Her Own, She's Overflowing With Motherly Affection (Married Woman Nozomi Haneda, Age 32)

  • nozomi haneda censoredcreampiemarried womanSYplumkanda river bluesamateur only plumSY-194SY194h-113sy00194
    • 2021-01-02
    78 min

    [opcyn-140]ゆりあ 3(28)

  • amateur censoredbig titsamateuropcynopcyn-140opcyn140opcyn-140
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-22
    140 min

    [IBW-815]S********ls Lured To A Local Apartment And Made To Fuck

  • amateur censoredbeautiful girlIBWi b worksIBW-815IBW815
    • 2021-01-22
    59 min

    [orex-196]もなちゃん

  • amateur censoredcreampieschoolgirlorexorex-196orex196orex-196
    • 2021-01-29
    48 min

    [MASE-011]Part-Time Housewife Sumire Ravished By A Burglar While Her Husband's Away! Stuffed Into A Closed And Stuffed Full Of Cock!

  • censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-011MASE01149mase00011
    • 2021-02-07
    121 min

    [LUKE-012]Slut Stepsister Who Tempts Me With Dirty Words Up Close To Me - Natsu Nishida

  • natsu nishida censoredslutlingerieLUKEdigital arkdigital ark digital arkLUKE-012LUKE012luke00012
    • 2021-02-13
    58 min

    Pacopacomama 021321_434 Horny mid-age woman who wants to be on top during sex Runa Akasaka

  • amateur uncensoredpacopacomama
    • 2021-02-22
    135 min

    [HOMA-102]The Night Before The Cultural Fair, I Experimented With Sex To My Heart's Content With 2 Otaku Babes From The Manga Research Club

  • mizuki yayoi inaba censoredcreampieschoolgirlHOMAh m p doramajo asagiriHOMA-102HOMA102homa00102
    • 2021-03-04
    184 min

    [SHIND-003]A Relentless Pervert Rides The Maso Train Home Invasion Record #5 6

  • censoredamateurSHINDshinkirousuzuki o maSHIND-003SHIND003h-1560shind00003
    • 2021-03-06
    155 min

    [SSIS-010]My Girlfriend Was Gone For Two Days, So I Banged Her Actress Buddy From Dusk Until Dawn. Riri Nanatsumori

  • nanatsumori riri censoredbig titssingle workSSISs1 no 1 stylemon cSSIS-010SSIS010ssis00010
    • 2021-03-12
    65 min

    [orec-718]れいちゃん

  • amateur censoredcreampieamateurorecorec-718orec718orec-718
    • 2021-03-19
    87 min

    300NTK-537 [Beautiful ass slender moody beautiful girl! !! ] Libido that can not be hidden! !! Muramura date with a beautiful girl flower shop over idols! !! Suspicion of being embraced! ？？ What is her determination to challenge with a apt T-back 

  • amateur censoredcreampieamateurntkntk-537ntk537300ntk-537
    • 2021-03-20
    66 min

    FC2PPV 1733673 [Leaked Maru video] I cup big breasts beautiful wife ❤️ Genuine first and last complete appearance NN Gonzo! [* Stopped without notice *]

  • amateur uncensoredfc2
    • 2021-04-02
    180 min

    [BF-628]I Lied To My Wife And Went On A 2-Day, 1-Night Hot Spring Resort Vacation With One Of My S*****ts. Nanase Asahina

  • asahina nanase censoreduniformschoolgirlBFbefreeroku yonBF-628BF628bf00628
    • 2021-04-08
    120 min

    [FSDSS-201]A Gloomy Middle-Aged Janitor Is Having A Relentless, Licking And Foreplay-Filled Stealth Fuck Fest With Her Every Day In The Office, And Now She's Hopelessly Hooked Kaname Momojiri

  • kaname momojiri censoredbig titsdramaFSDSSfalenoyamaguchi memberfaleno starFSDSS-201FSDSS2011fsdss00201
    • 2021-05-06
    76 min

    200GANA-2482 Seriously Nampa, first shot. 1632 I should have just shown a picture of my pet … A slender busty beauty who has been played with her chemo ears before I knew it! There is a pet’s qualities, a figure that hangs down and hangs do

  • amateur censoredbig titsamateurganagana-2482gana2482200gana-2482
    • 2021-05-10
    96 min

    374IMGN-012 Mie (26)

  • amateur censoredcreampieamateurimgnimgn-012imgn012374imgn-012
    • 2021-05-23
    65 min

    HEYZO 2531 Amateur Girl With Graffiti On Her Body Gets Orgasm Vol.2 – Mami Sekimoto

  • mami sekimoto uncensoredcreampieheyzo
    • 2021-06-04
    51 min

    520SSK-004 Akari

  • amateur censoredcreampiebig titssskssk-004ssk004520ssk-004
    • 2021-06-19
    54 min

    H4610 tk0037 Shiori Tokushita 20years old

  • amateur uncensoredh4610
    • 2021-07-03
    88 min

    DCH-004 Mai

  • amateur censoredcreampiebig titsdchdch-004dch004dch-004
    • 2021-07-20
    41 min

    H0930 ki210720 Noriko Owada 42years old

  • amateur uncensoredh0930
    • 2021-07-29
    92 min

    [FUGA-049]The Wife Who Will Fuck The Criminal To Get Back Her K****pped Husband: Yuka Mizuno

  • yuka mizuno censoredcreampiemarried womanFUGAcenter villagejiro fukagawaparadise center villageFUGA-049FUGA049h-086fuga00049
    • 2021-08-12
    58 min

    FCP-034 [Delivery Only] Instead Of Angry Waves, Double Facial Cumshots! !! The Limit To Squeeze Until Empty!

  • amateur censoredamateurslutfcpfcp-034fcp034fcp-034
    • 2021-08-13
    119 min

    [JYMA-013]A Perverted Wife With 2 Fetishes. Colossal Tits Ass Bitch M-Slut Celebrity Wife. The Quarter Housewife With J Cup Titties And Extreme Ass.

  • censoredcreampiebig titsJYMAtsukuzuku onna wa tsurai yobuddha dgroupJYMA-013JYMA013jyma00013
    • 2021-08-19
    72 min

    [ETQR-271](Daydream POV Fantasies) I"m A Newlywed, And After Losing My Shit, To My Surprise, I Spent The Night At A Hotel With My Colleague Hana Himesaki

  • himesaki hana censoredcreampiebig titsETQRerotic timeETQR-271ETQR271etqr00271
    • 2021-08-26
    93 min

    [OKP-090]Misuzu Kashii Divine Pantyhose Office Lady Edition We"re Bringing You An Office Lady Who Wears Business Suits To Go With Her Beautiful Legs Wrapped In Naughty And Nasty Pantyhose For Fully Clothed Musty Sniffing Pleasure, From Her Soles

  • kashii misuzu censoredsingle workbukkakeOKPoyaji no kosatsukouenji gorokami pantyhoseOKP-090OKP0901okp00090
    • 2021-08-30
    47 min

    FC2PPV 2110084 [One Day Limited 2200 → 1200pt] [Individual Shooting] My Favorite Black Hair Short! Playing With A Beautiful Busty Niece And Getting Pregnant And Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-09-09
    21 min

    HEYZO 2606 Erotic Massage for Rina – Rina Ebina

  • rina ebina uncensoredcumshotheyzo
    • 2021-09-18
    42 min

    276KITAIKE-496 Rika-San

  • amateur censoredcreampieamateurkitaikekitaike-496kitaike496276kitaike-496
    • 2021-09-24
    120 min

    [DFDM-023]Super Close-up! Fleshy Oil Beauty Treatment Salon - Yuria Yoshine

  • yoshine yuria censoredbig titsblowjobDFDMwaap entertainmenteightfearlessDFDM-023DFDM0232dfdm00023
    • 2021-09-28
    46 min

    FC2PPV 2258281 780 Yen! [4K Video] Norinori 3p! Even Though It’s Just After Debut, It’s Switched On And It’s A Nasty Play ♪ Creampie & Mouth Shot! Plump Busty Ring G Cup 19 Years Old JD1 Himari-Chan Chapter 1 _ Bonus

  • amateur uncensoredfc2
    • 2021-10-01
    85 min

    406FTHT-024 [Cute With Anime Voice Is A Great Weapon! The Piston Shines! A Whip Butt That Pops! Service Princess] Aggressive Excess Lip Service! A Rich Blowjob With An Upper Eye That Tickles The Man’S Heart! Irama In The Back Of The Throat Is Al

  • amateur censoredcreampieamateurfthtftht-024ftht024406ftht-024
    • 2021-10-21
    137 min

    [PARM-169]Super Real!! Model Let Me Take Pictures Of Her Wet Panties

  • censoredbeautiful girlPARMaroma kikakumousou chirarizumuPARM-169PARM169parm00169
    • 2021-10-22
    29 min

    FC2PPV 2363799 [Leakage] * Sold For A Limited Time * S-Class Mammoth Company, Beauty Receptionist, Counter Breakout, Blow Job Outflow In A Private Room As A Crackdown [Handling Precautions]

  • amateur uncensoredfc2
    • 2021-11-01
    130 min

    [NACR-472]Love Cum Swallowing! A Total Slut Who Fucks Anyone!! Mei Satsuki

  • satsuki mei censoredcreampieblowjobNACRplanet plushimurokkushichi ku ryuuNACR-472NACR472h-237nacr00472
    • 2021-11-27
    61 min

    Pacopacomama 112721_564 Mature Woman With A Certain Situation Nono Otsuki

  • amateur uncensoredpacopacomama
    • 2021-11-30
    48 min

    H4610 ki211130 Akina Koizumi 21years old

  • amateur uncensoredh4610
    • 2021-12-04
    136 min

    [DAYA-017]Gal Model Himari (25 Years Old) Has Middle-Aged Guy By The Balls Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobslutDAYAdigital arkyumeno aidadigital ark dejitarua kuDAYA-017DAYA017daya00017
    • 2021-12-10
    56 min

    NKDS-206 Arisa (Alisa Shitara)

  • amateur censoredcreampiebig titsnkdsnkds-206nkds206nkds-206
    • 2021-12-14
    480 min

    [MUCH-142]8 Hours And 2 Discs Of Sex With 10 Women With Big Tits And Shaved Pussies

  • enomiya shiori tsukada censoredbig titsMUCHmothermuchimuchiMUCH-142MUCH142h-796much00142



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored