nampa javcensored amateur high visio




FC2FSDSSMIDVCAWDNNPJADNSHKDPPPDMIDENGODSSISBLKATIDSQTECHRVDASDMEYDMVSDVEMAHNDGVH

2020-10-19
36 min

FC2PPV 1539829 [Personal shooting / Creampie] I bought a 30-year-old married woman who was bred. I continued to groan in agony and pleasure repeatedly due to relentless denma blame …

  • amateur uncensoredfc2
    • 2020-10-23
    115 min

    [PARATHD-3025]I Left My Sexually Frustrated Wife Alone With My Well-Endowed Subordinate. Deluxe Edition (3)

  • censoredmarried womanamateurPARATHDparadise tvPARATHD-3025PARATHD3025parathd03025
    • 2020-10-24
    53 min

    1Pondo 102420_001 Welcome To Luxury Spa: Maina Ito Marina Sato

  • amateur uncensored1pondo
    • 2020-11-06
    121 min

    [SSNI-915]Fresh Face NO. 1 STYLE Kanon Tsukishima AV Debut

  • tsukishima kanon censoredblowjobbeautiful girlSSNIs1 no 1 stylemichiru arashiyamaSSNI-915SSNI915ssni00915
    • 2020-11-19
    120 min

    [JYMA-004]She's Got Her Husband's Permission To Star In Porn! Raging Nympho Bride Offers Up Her Anal Hole To Other Guys To Enjoy - Her Big Tits Filmed With A Fish Eye Lens Just To Get Them All In

  • censoredcreampiebig titsJYMAjukujo ha tsurai yobuddha dmanji groupJYMA-004JYMA004jyma00004
    • 2020-11-23
    144 min

    [KSAT-025]Quickie With A Married G-Cup - Love Hotel Creampie 30-Year-Old Kaori

  • censoredcreampiebig titsKSATstrong woman s table daydream tribetable of a strong womanKSAT-025KSAT025ksat00025
    • 2020-11-26
    102 min

    [SPRD-1350]Shameful Creampie With My Stepmom A Stepmom Who Got Creampie Fucked For The First Time By Her Stepson Kazumi Nakagishi

  • kazumi nakagishi censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1350SPRD135018sprd01350
    • 2020-12-05
    238 min

    [HUNTA-904]"Stop! Please! Take It Out Already! How Many Times Are You Going To Cum In Me!？" Outstanding Cherry Boy Can't Stop Cumming Inside His Sweet Mother-In-Law No Matter How Many Times He's Already Ejaculated!

  • censoredcreampiebig titsHUNTAhuntervolvo nakanohhh groupHUNTA-904HUNTA904hunta00904
    • 2020-12-06
    119 min

    [BKD-252]Family Fun [Yunishigawa Onsen Road] Arisa Shitara

  • shitara arisa censoredcreampiemature womanBKDrubykoji tsujitobijiBKD-252BKD252bkd00252
    • 2020-12-22
    117 min

    [MSB-003]Fucking Another Man's Wife And Giving Her A Raw Creampie 3! 13 Years Married / Living In Hamamatsu, Shizuoka / 3 K*ds / Beautiful Impish Woman With Shaved Pussy (39) - Insatiable Sex Drive, Black Hair, Neat And Clean Cock-Loving Housewif

  • amateur censoredcreampieamateurMSBfutureMSB-003MSB003
    • 2021-01-13
    50 min

    320MMGH-285 Picking up amateur women at the end of the mirror issue again. Refill SEX voyeur video released without permission. Miu (21)

  • amateur censoredcreampieamateurmmghmmgh-285mmgh285320mmgh-285
    • 2021-01-20
    180 min

    [FUFU-196]Sore Wives Tricked Into Erotic Massages... 180 Minutes

  • asako morishita aya ikegami censoredamateurmature womanFUFUstar paradisefufuFUFU-196FUFU196h-254fufu00196
    • 2021-01-23
    149 min

    [HND-943]This Pay-For-Play Gal Is Usually A Cold Fish During Sex, But When She Won The Lottery She Immediately Changed Her Tune! This Slut Kept On Begging For Creampie Sex While Earning Tips. Hina Nanami

  • hina nanami hina nanase censoredcreampieblowjobHNDhon nakausa pyonHND-943HND943hnd00943
    • 2021-01-23
    56 min

    FC2PPV 1657060 [Uncensored / Individual shooting] Gonzo with a girl who is too sensitive and horny ♪ Shake your hips and cum ❤️❤️ Creampie in a beautiful beautiful man!

  • amateur uncensoredfc2
    • 2021-02-07
    240 min

    [MMB-348]Head Over Heels For Curvy, Soft, Squishy, Bouncy Marshmallow Bodies - 4 Hours

  • kina shinozaki shizuka omori censoredcreampieMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-348MMB348mmb00348
    • 2021-02-11
    131 min

    [PIYO-104]Your Cousin Is A Blowjob Bitch! "You're The Reason Why I Like To Give Men A Blowjob So Much!" After Secretly Grooming Her To Suck Your Dick, Your Little Cousin Has Transformed Into A Blowjob Bitch, And Now She'll Keep On Suc

  • censoredcreampieschoolgirlPIYOhyokopiero dabicchiPIYO-104PIYO1041piyo00104
    • 2021-02-12
    117 min

    [MUKC-015]A Famous Cosplayer's Cosplay Sex - Eimi Fukada

  • emi fukada censoredcreampiecosplayMUKCmukuinnocent cosplayMUKC-015MUKC015mukc00015
    • 2021-02-12
    160 min

    [MEYD-653]The Married Woman Next Door Set Up A Massage Parlor In Her House. I Keep Hearing Guys' Screams, So I Nervously Made My Own Appointment, And She Treated Me To A Full Course Of Nut-Busting Slut Treatments Until I Almost Swooned! Nanami Ka

  • kawakami nanami censoredcreampieslutMEYDtameike goroMEYD-653MEYD653meyd00653
    • 2021-02-13
    47 min

    188HINT-0438 Hisae

  • amateur censoredmarried womanamateurhinthint-0438hint0438188hint-0438
    • 2021-03-01
    46 min

    324SRTD-0218 Gal school girls are too good at 3 shots 1 cum shot

  • amateur censoredcreampieuniformsrtdsrtd-0218srtd0218324srtd-0218
    • 2021-03-18
    58 min

    FC2PPV 1730846 Big boobs world tremor! Miraculous I Cup Ubu Bishoujo First Leak [Limited Premier]

  • amateur uncensoredfc2
    • 2021-04-06
    132 min

    [KIRE-033]Climaxing 52 Times! 3 Cum Shots! Ripe H-Cup Body Shakes And Convulses To The Limit! Female CEO Is Fucked And Has Her Titties Groped By A Younger Man Yumi Narusaki 46 Years Old

  • grace narisaki censoredbig titsmature womanKIREsod createyosukebeauty kirei sodKIRE-033KIRE0331kire00033
    • 2021-04-27
    41 min

    Pacopacomama 042721_465 Cum On Tits Special: Natsuki Kikuta, Yuki Shinoda, Nanako Asahina

  • amateur uncensoredpacopacomama
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-11
    58 min

    H0930 ki210511 Noriko Kakei 34years old

  • amateur uncensoredh0930
    • 2021-05-19
    129 min

    [GVH-235]Booty-Loving Brat's Naughty Pranks Hikaru Konno / Ameri Hoshi

  • hikaru konno star ameri censoredGVHglory questtsunemori takahashiGVH-235GVH23513gvh00235
    • 2021-06-10
    240 min

    [SW-779]I Went To A Coed Hot Spring Resort Filled With Nothing But Women, And I Was The Only Man There 15 Big Tits Mamas A 240-Minute Special Faced With All These Huge Tits, My Adolescent Cock Was Rock Hard And Ready To Roll, So I Squeezed It Hard, P

  • censoredbig titsmarried womanSWswitchyocchanswitch switchSW-779SW7791sw00779
    • 2021-06-16
    119 min

    [SSIS-095]Taken Over By A Mania For Track And Field Y********l In A School Uniform Has Secretly Filmed Bizarre Footage Of Her Taken By A Stalker Leaked Izuna Maki

  • izuna maki censoredschoolgirlsingle workSSISs1 no 1 stylegoemonSSIS-095SSIS095ssis00095
    • 2021-06-25
    66 min

    FC2PPV 1887889 [14980 → Limited number 4980] [Complete appearance] Active apparel model ❤️ Life pain Gonzo ❤️ Ojisan raw Gonzo ❤️ Die with toys and meat sticks ❤️ DNA implantation with ruthless vaginal ejaculation * Review privilege Ali

  • amateur uncensoredfc2
    • 2021-07-14
    64 min

    SIRO-4557 [First Shot] [Beautiful Big Breasts X Momojiri] [Naka Dies Continuous Cum Daughter] Immediately After F Milk, A Professional Student Masturbates While Watching Av Every Morning And Evening Routine. Naka School Beautiful Naked Body Convulsio

  • amateur censoredbig titsamateursirosiro-4557siro4557siro-4557
    • 2021-07-14
    57 min

    510ELLO-012 Concafe Nampa Mikuru chan

  • amateur censoredamateurelloello-012ello012510ello-012
    • 2021-07-15
    112 min

    [DDOB-095]Brainwashing so that I Can Come in Her Pussy. Jun Haruaki.

  • jun shunmei censoredcreampiemature womanDDOBdogmatenunmy auntDDOB-095DDOB095ddob00095
    • 2021-07-28
    58 min

    SIRO-4581 [First Shot] [Resilient Beautiful Breasts X Elastic Ass] [Tangled Rich Blowjob] The Crepe Shop Clerk With A Cute Smile Is A Carnivorous System. Stimulated By The Body Of M Temperament, When The Switch Comes In, Licks The Meat Stick Deliciou

  • amateur censoredamateursirosiro-4581siro4581siro-4581
    • 2021-08-11
    47 min

    500DPL-0034 Host Mad Woman Cum Inside Gonzo Approved! Mizue

  • amateur censoredcreampieamateurdpldpl-0034dpl0034500dpl-0034
    • 2021-08-20
    85 min

    FC2PPV 2051731 [Personal Shooting] I Went For A Walk Date With That Child Of J Cup God Style And Tried Out Unauthorized 2 Consecutive Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-08-29
    72 min

    FC2PPV 2101993 [Pre-Sale] Mayu-Chan, A Tall Slender Beauty, 4th Time-I Was In Heat With A Race Queen Costume And Decided To Make Two Consecutive Vaginal Cum Shots ♥

  • amateur uncensoredfc2
    • 2021-09-01
    120 min

    [GVH-284]Dirty Wife With No Bra And Panties Moves In Next Door Karen Asahina

  • karen asahina censoredslutsingle workGVHglory questkisakura kabinGVH-284GVH28413gvh00284
    • 2021-09-02
    64 min

    494SIKA-107 De M Daughter Strangles Infinitely With A High Speed ​​Piston

  • amateur censoredbig titsamateursikasika-107sika107494sika-107
    • 2021-09-04
    112 min

    [XVSR-609]Hot Sex: Hana Himesaki"s Real Creampie Sex

  • himesaki hana censoredcreampiebig titsXVSRmax ayoshida ikuzoucalenXVSR-609XVSR609xvsr00609
    • 2021-09-05
    115 min

    [083PPP-2231]【松島さん家の3世代近●相姦】「お義母さんのおっぱいすっごいスケベでしょ？」誘惑ハンパないGカップママのカラダがエロ過ぎて我慢できず中●し！

  • amateur censoredbig titsamateurpppppp-2231ppp2231083ppp-2231
    • 2021-09-25
    123 min

    [MGMQ-081]Delirium Inducing Anal Play From The School Nurse For A Masochist. Nanako Miyamura

  • nanako miyamura censoredanalslutMGMQmegamibijo shin queenMGMQ-081MGMQ081mgmq00081
    • 2021-09-25
    81 min

    521MGFX-024 Beautiful Girl With Long Nipples In The Complex

  • amateur censoredamateurbeautiful girlmgfxmgfx-024mgfx024521mgfx-024
    • 2021-10-13
    42 min

    229SCUTE-1137 Kono wa (Narumi Konowa)

  • amateur censoredbig titsamateurscutescute-1137scute1137229scute-1137
    • 2021-10-16
    130 min

    [AVSA-182]These Wicked Women Vowed To Get Revenge, So We Used Aphrodisiacs To Get Them Hooked On Sex Churin Nakazawa

  • chuzawa nakazawa censoredsingle workAVSAavsariari sanpeiavscollectorsAVSA-182AVSA182avsa00182
    • 2021-10-16
    124 min

    [ZOCM-008]We"ll Deliver A Married Woman Slut To Your Door. Ai-san 29 Years Old Ai Kawana

  • ai kawana censoredcreampieslutZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-008ZOCM008zocm00008
    • 2021-10-20
    140 min

    [VNDS-3378]A Beautiful Married Woman Bashfully Participates In A Masturbation Watch Party

  • ichinose ayame akizono koe censoredblowjobmature womanVNDSstar paradisenext11VNDS-3378VNDS3378h-254vnds03378
    • 2021-10-29
    62 min

    530DG-031 [Voyeur In The Fitting Room] Stupor Video ＃ 3

  • amateur censoredcreampiebig titsdgdg-031dg031530dg-031
    • 2021-11-13
    210 min

    [KDMI-040]Girls in High Cut Leotards. Suite. Amazing.

  • akari shinmura miina wakatsuki censoredslutKDMImiruyumeno aidaKDMI-040KDMI040kdmi00040
    • 2021-12-11
    159 min

    [MDBK-212]A Certain Traditional Inn Offers the Present Age"s Red Light District in the Shadows. Creampie. Slut Club

  • nene tanaka takarada monami censoredcreampiebig titsMDBKbazookamaso knifeMDBK-212MDBK212mdbk00212
    • 2021-12-17
    143 min

    [MUDR-172]If This Face Rings A Bell, Report It Immediately! The New Wanted System: Anyone Can Fuck And Nakadashi A Beautiful Girl Anytime They Want!

  • satsuki mei censoredcreampiebig titsMUDRmukuMUDR-172MUDR172mudr00172
    • 2021-12-18
    123 min

    [ZOCM-014]Her Titties Were So Big, They Were Bursting Out Of Her Uniform, And Setting The Internet On Fire! This Colossal Tits Beautiful Girl Was Hotly Rumored Online, With Her 101cm J-Cup Titties, And How Good She Looked In Uniform, But It Turns Out

  • suwon miso censoredcreampiebig titsZOCMthrilling girls the daydream tribetodothrilling girlsZOCM-014ZOCM014zocm00014
    • 2021-12-18
    155 min

    [MMKZ-105]Her Huge Ass Is Plump And Bouncy Tamaki Kurumi

  • tamaki walnut censoredsingle workMMKZmarrionmiyamoto kojirouirisMMKZ-105MMKZ105mmkz00105
    • 2021-12-23
    139 min

    [IENF-183]Ena Satsuki. A Top Class Beautiful Girl. Creampie Baths.

  • ena satsuki censoredcreampiesingle workIENFienergykikurinieneIENF-183IENF1831ienf00183
    • 2022-01-06
    109 min

    [AARM-050]Lap Up Her Nipples And Squeeze Your Cock With Her Tight Ass While She Swoons - Edged Until She Lets You Blow Your Load On Her Thighs

  • akari shinmura erika sasanami censoredAARMaroma kikakukadowaki shigeoaromaAARM-050AARM050aarm00050
    • 2022-01-22
    212 min

    [MADV-515]POV Shots Of S********l In A Uniform Getting Fucked Raw 3 Punk Girl + Beautiful Legs + Spoiled Brat All Shaved Pussies 3 Ejaculations

  • rurucha aisu minon censoredschoolgirlMADVcrystal eizomaniac crystalMADV-515MADV515madv00515
    • 2022-02-12
    124 min

    [ZOCM-024]Sharing A Hotel Room... Is How I Wound Up Cheating. Adorable Female Coworker And Her Sullen (Married) Supervisor Can"t Keep Their Hands To Themselves On A Business Trip And Wound Up In A Workplace Affair. Mikako Horiuchi

  • mikako horiuchi censoredcreampiesingle workZOCMthrilling girls the daydream tribetodothrilling girlsZOCM-024ZOCM024zocm00024



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored