nasty hard high vision javcensored jav creampie




FC2AMBIAUKSMARAABWNACRHODVKSBJAVSAHUNTBSPRDDTTSQTESSNIMIDECAWDVEMADASDAWDGMEMBBAN

2021-01-20
130 min

[GVH-181]I'm Your Sex Pet... You Can Order Me To Do Whatever You Want, And I'll Obey... Awakening As A Sub Urara Kanon

  • hanaoto urara censoredbdsmsingle workGVHglory questGVH-181GVH18113gvh00181
    • 2021-02-11
    127 min

    [MEKO-203]All New "The Old Lady Rental" Service 07 I Heard About This Housecleaning Service That Would Let You Have Creampie Sex, So I Decided To Make Even More Extreme Demands

  • censoredcreampieamateurMEKOmature woman laboMEKO-203MEKO203h-1160meko00203
    • 2021-02-19
    36 min

    [BTH-121]I Want To Cum On The Face Of A Girl Like That Mikako Abe

  • abe mikako censoredbeautiful girlbukkakeBTHchobitchchovicBTH-121BTH121h-1435bth00121
    • 2021-02-19
    84 min

    383REIW-048 Yuki

  • amateur censoredcreampieamateurreiwreiw-048reiw048383reiw-048
    • 2021-03-02
    58 min

    C0930 ki210302 Midori Kimishima 23years old

  • amateur uncensoredc0930
    • 2021-03-09
    481 min

    [KTRA-283]A Big Tits Beautiful Girl Has Sex With 10 Men In A Row Vol.5 8 Hours 2-Disc Set

  • kawaon walnut ann wakamoto censoredcreampiebig titsKTRAk tribeKTRA-283KTRA283h-094ktra00283
    • 2021-03-12
    85 min

    [DHT-254]Cute And Beautiful E-Cup Wife With Big Bright Eyes Like A Doll Nozomi 28 Years Old

  • censoredcreampiebig titsDHThot entertainmentstudio zeroDHT-254DHT25459dht00254
    • 2021-03-13
    117 min

    [MIDE-895]A Female Teacher Is Held In Confinement This S*****t Loves Rough Sex And Now He's Got A Plan To Transform Her Into His Own Free-For-All Fuck Hole Rei Futami

  • rei futami censoredsquirtingsingle workMIDEmoodyzdragon nishikawamoodyz divaMIDE-895MIDE895mide00895
    • 2021-03-19
    67 min

    [sika-059]通野ちゃん(27)

  • amateur censoredcreampieamateursikasika-059sika059sika-059
    • 2021-03-20
    180 min

    [OFKU-178]The Bride's Mother Was Beautiful And Sexy For A Forty-Something Lady, And Her Son-In-Law Got Hot And Horny For Her Ripened Body And Popped His Cock In Raw 180 Minutes

  • kana suruga fukuyama iroha censoredcreampieblowjobOFKUstar paradisemom railOFKU-178OFKU178h-254ofku00178
    • 2021-03-21
    60 min

    413INST-106 After all raw feels good! Swimming club JD Maina-chan (20) who is addicted to sex without rubber If the nipple is too weak and cramped, it will be intensely iki vagina Kyun convulsions stop )

  • amateur censoredcreampieamateurinstinst-106inst106413inst-106
    • 2021-03-21
    118 min

    [NNPJ-438](*A Super Rare Discovery That You Can Only See Right Now) A Big Tits College Girl (Estimated Titty Size: J-Cup) Who Is Currently Studying Overseas Is Learning About The State Of Society And Immediately Cumming Home To Star In This Adult Vid

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-438NNPJ438nnpj00438
    • 2021-03-24
    114 min

    241GAREA-509 Mikurin

  • amateur censoredamateurgareagarea-509garea509241garea-509
    • 2021-04-01
    158 min

    [SW-129]Cougars With Issues: Amateur Creampies Minori 45 Years Old She's A Forty-Something Mature Woman Like The Kind You Find Pictured In Erotica Magazines, Discarded By The Riverbed ... Such A Filthy, Naughty Body ...

  • censoreduniformbeautiful girlSWswitchtakeshi yamashiroswitch switchSW-129SW1291sw00129
    • 2021-04-07
    62 min

    422ION-0066 A Big Tits Beauty Who Was Taken Down By A Store Manager Who Bytes Ahead

  • amateur censoredcreampieamateurionion-0066ion0066422ion-0066
    • 2021-04-07
    28 min

    FC2PPV 1758624 [First shot / sold out] Former local idol self-activity fund, 2 cum swallows BJJ indies ＃ 10

  • amateur uncensoredfc2
    • 2021-04-20
    56 min

    10musume 042021_01 BJ In Public Restroom: I met with a popular metamorphosis woman on SNS Momoko Kozuka

  • amateur uncensored10musume
    • 2021-04-21
    35 min

    492JCHA-015 Well, I’m always picking up

  • amateur censoreduniformschoolgirljchajcha-015jcha015492jcha-015
    • 2021-04-24
    49 min

    FC2PPV 1784590 * Deleted without notice [Clothing fucking pinch] My friend’s sister has a two-dimensional body! Icup beautiful girl wearing a cow pattern costume and fucking from a close contact massage!

  • amateur uncensoredfc2
    • 2021-05-05
    240 min

    [SCR-271]Video Of Rough Sex By Horny Men Who Enter The Bathing Area Without Permission - 4 Hours

  • censoredcreampieSCRgrayss crimeSCR-271SCR27112scr00271
    • 2021-05-20
    152 min

    [FSDSS-232]Amateur Real Life College Girl Is Interested In The World Of Porn Rin Natsuki Porn Debut

  • rin natsuki censoredbig titsbeautiful girlFSDSSfalenosatoshi maedafaleno starFSDSS-232FSDSS2321fsdss00232
    • 2021-06-01
    63 min

    200GANA-2488 In the spear room of the Nampa master of 100 battles, bring in SEX hidden shooting 205 Innocent Musume with a dazzling smile and drinking at home! The blow job that makes a jubojubo sound is too erotic … The beautiful body that is t

  • amateur censoredamateurganagana-2488gana2488200gana-2488
    • 2021-06-10
    93 min

    [OKB-113]Chiharu Sakurai A Voluptuous Big Ass A Goddess In Bloomers From A Lolita Beautiful Girl, To A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Puss

  • chiharu sakurai censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-113OKB1131okb00113
    • 2021-07-02
    108 min

    [ADN-330]Naughty Teacher Returns To His Alma Mater To Creampie Fuck His Former S*****t For Two Weeks Straight. Hikari Ninomiya

  • hikari ninomiya censoredcreampiesingle workADNattackerssadao sadaokaotona no dramaADN-330ADN330adn00330
    • 2021-07-06
    57 min

    FC2PPV 1906488 [Adolescent idol] K② Musume half-beautiful girl kissed by a handsome boyfriend ♥ The sexual desire is too strong and cums 10 times in a row in 60 minutes & continuous raw vaginal cum shot leaked from college boyfriend [Gachi Acme]

  • amateur uncensoredfc2
    • 2021-07-09
    120 min

    [MUDR-154]Ever Since That Day... Breaking In A Beautiful Y********l In Uniform With S&M Creampie Sex Aoi Nakajo

  • nakagusuku censoredcreampieuniformMUDRmukuMUDR-154MUDR154mudr00154
    • 2021-07-30
    85 min

    483SGK-035 "Unrivaled Ji ● Po Love" "Innocent Girl In The Country" "Gutchori Wet Wet Constitution" "Ecchi For The First Time In A Year" "Super Do M Ichayo Climax" A Country Girl Working At A Factory From T

  • amateur censoredamateursgksgk-035sgk035483sgk-035
    • 2021-07-31
    240 min

    [MLSM-050]An Extraordinarily Beautiful Mature Woman: The Best of Yuri Nikaidou. Four Hours of A Madonna With Big Tits and Beautiful Legs.

  • yuri nikaido censoredcreampiebig titsMLSMmellow moonMLSM-050MLSM050mlsm00050
    • 2021-08-07
    87 min

    FC2PPV 1966864 [Big Butt] A 20-Year-Old College Student With Plenty Of S Was Squeezed From The Back And Passed Away And It Was Strong And Cute ★ First Double Privilege & Discount Price ★

  • amateur uncensoredfc2
    • 2021-08-19
    53 min

    FC2PPV 2044511 [Graduation From Virginity] The Case Where I Graduated From Virginity With A Vaginal Cum Shot For The First Time On An Airplane From A Rural Area (Celebration) * First Shot, Mask Facial Cumshot

  • amateur uncensoredfc2
    • 2021-09-02
    114 min

    [AARM-011]Latex Tight Mini x Thicc Thigh Job

  • chaoyang ema kira an censoredslutAARMaroma kikakukadowaki shigeoaromaAARM-011AARM011aarm00011
    • 2021-09-04
    137 min

    [BAHP-087]I Became A Porn Actress -Innocent Type College Girl Cums Hard In Porn Debut- Mayu Omikawa

  • mayu komikawa censoredcreampiesingle workBAHPbarutanyoshida daibutsuhoppinBAHP-087BAHP087bahp00087
    • 2021-09-14
    41 min

    H4610 ki210914 Haruka Tasaki 26years old

  • amateur uncensoredh4610
    • 2021-09-17
    150 min

    [EYAN-173]162x Climaxes! 112x Body Twitches! Squirting 4,000ml! Huge Busty J-cup Married Woman. First-time Creampie And Raw Fucking Climax Documentary. Miki Shiraishi

  • miki shiraishi censoredcreampiebig titsEYANe bodymonhanazakari no tsumatachiEYAN-173EYAN173eyan00173
    • 2021-09-30
    150 min

    [DIC-092]18歳と7ヶ月。 18 ミニマム145cm×美パイパン×膣奥イキ絶頂 愛野ひなた

  • amateur censoredsquirtingamateurdicdic-092dic092dic-092
    • 2021-10-01
    38 min

    FC2PPV 2280263 Until Today! Appearance! "# 7" Wakeari Student. Staying Raw Etch. Serve As A Maid The Next Morning ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-10-11
    115 min

    503KOO-023 Mayu (Mayumi Komikawa)

  • amateur censoredbig titsamateurkookoo-023koo023503koo-023
    • 2021-10-18
    76 min

    530DG-016 ＃ 04 Female College Students Who Are Abandoned On The Emergency Stairs Of The Building At The New Welcome Party And Fall Asleep

  • amateur censoredcreampiebig titsdgdg-016dg016530dg-016
    • 2021-10-25
    56 min

    FC2PPV 2371140 Until 10/26 [5000pt → 1000pt] [Face Barre] [Problem That Disappeared In 5 Days] If You Abuse The Business Card You Got From A Friend Of "A Famous Music Producer", You Will Serve A 23-Year-Old Beautiful Woman Who Dreams Of Being

  • amateur uncensoredfc2
    • 2021-10-29
    121 min

    [JUTA-124]The Best!! A Porn Documentary of the First Undressing of a Wife in Her Fifties. Maki Sumikawa

  • maki sumikawa censoredcreampiemature womanJUTAjuku onna japan emmanuelletokugawa museijuku onna japanJUTA-124JUTA124juta00124
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-06
    219 min

    [BAZX-315]Thick Sex With A Widow In Mourning Dress vol. 006

  • censoredcreampieBAZXk m producetodobazookaBAZX-315BAZX315bazx00315
    • 2021-11-16
    59 min

    SIRO-4669 [First Shot] [Elegant Appearance] [Sigh That Leaks Indecently] Politeness ○ A Beautiful Tutor Who Has Both Wisdom And Bewitching Advent. The Intense Piston From Her Back Writhes Her Outstanding Style, And While She Has An Ecstatic Expressio

  • amateur censoredamateursirosiro-4669siro4669siro-4669
    • 2021-11-20
    132 min

    [SCPX-436]My Step Father-in-law Suddenly Kissed Me So Well That I Lost My Back And Felt My Body Warp, And My Earnest Wife Instantly Turned Into A Female In Heat!

  • censoredcreampieSCPXscoophasshimousouzokuSCPX-436SCPX436scpx00436
    • 2021-11-22
    66 min

    OREX-324 Miku-chan (Miku Kurusu)

  • amateur censoredcreampieschoolgirlorexorex-324orex324orex-324
    • 2021-11-25
    29 min

    FC2PPV 2463741 ★ New Sale In Progress [Ochinpo Polish → Close-Up Shot → Back Streak Launch → Cleaning Blow Job] Very Popular Sequel! !! 2nd [Tamaki-Chan] Blow Specialization

  • amateur uncensoredfc2
    • 2021-11-30
    241 min

    [RD-1090]Mature Woman Sex Drama Complete Collection Athena Erotica 10 Men Four Hours "Forgive Me Already!"

  • amateur censoredmarried womanmature womanRDatena eizouRD-1090RD1090
    • 2021-11-30
    120 min

    [SAN-030]Beautiful Big Tits Wife Who Cannot Forget Cuckolding Dick That Was Bigger And Harder Than Husbands Has Dick Delivered. Riho Takahashi

  • riho takahashi censoredbig titssingle workSANmazagod maramother mazaSAN-030SAN030h-796san00030
    • 2021-12-03
    123 min

    [TPPN-212]A New Face Debut This Girl With J-Cup Colossal Tits Is A Genuine Maso Bitch She Exceeded All Expectations! A Sure Thing Sexual Monster! A Sex-Crazed Girl Is Losing Her Mind In Continuous, Demonic Orgasmic Sex Uta Ando

  • ando poetry censoredbig titsbeautiful girlTPPNteppanTPPN-212TPPN212tppn00212
    • 2021-12-04
    119 min

    [GVH-329]A Step-Mom"s Real Sex Education. Ayame Kinoshita

  • kinoshita ayame censoredcreampiebig titsGVHglory questtakahashi chitsujiGVH-329GVH329gvh00329
    • 2021-12-09
    79 min

    FC2PPV 2504284 [Limited Time 1980] Debt 150. A 20-Year-Old Young Wife Who Is Part-Time At The Reception Desk Of A Dentist. She Is 148cm / Ecup Erotic Body. Although She Hates Her, Her Cute Pant Voice Comes Out. She Made Vaginal Cum Shot Without Permi

  • amateur uncensoredfc2
    • 2021-12-09
    158 min

    [SPRD-1495]After The Class Reunion... Honoka Tsuji

  • tsujii honoka censoredmature womansingle workSPRDtakara eizoutakara hiroshialeddinSPRD-1495SPRD149518sprd01495
    • 2021-12-24
    160 min

    [HUNBL-073]Deep Throating Of A Tutor Who Runs Away From Home For 60 Minutes Deep Throat

  • censoredcreampiedeepthroatHUNBLhunterbajiohhh groupHUNBL-073HUNBL073hunbl00073
    • 2021-12-25
    97 min

    300MAAN-731 [Orthodox Beautiful Girl Is Endless Tide Iki] [Accompanied By Sea Pic From Nampa In Odaiba] [Hotein Is Persuaded By A Handsome Staff Similar To A Former Boyfriend! ？？ ] [Cute, Thin, Long Legs, Erotic] ​​[Embarrassing But Squirting Does No

  • amateur censoredcreampiesquirtingmaanmaan-731maan731300maan-731
    • 2022-01-18
    53 min

    [324SRTD-0268]静岡でナンパした女学生がエロすぎて3発射した件

  • amateur censoredcreampieuniformsrtdsrtd-0268srtd0268324srtd-0268
    • 2022-01-21
    119 min

    [ROE-041]Even Though They"re Older My Mom And Dad Still Take Baths Together Suzuka Kisaki

  • kisaki suzuka censoredcreampiebig titsROEmadonnahimu lockmonroeROE-041ROE041roe00041



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored