natsumi




FC2MEYDMARAGVHNACRPPPDSTARSMVSDDASDWANZVENUCAWDADNSANFSDSSKSBJVEMABLKJULROYDIPX

2020-10-09
68 min

[EMOI-027]An Emotional Girl / Threesome Sex In An Open Air Bath / Fucking In The Open Air / Yukata Kimonos / E-Cup Beautiful Tits / 168cm Tall / Mugi Honjo (20)

  • barley censoredamateursingle workEMOIsod createhajime yanaiemotional girlEMOI-027EMOI0271emoi00027
    • 2020-10-09
    115 min

    [PARATHD-3013]Picking Up Girls In The City "Show Us Your Shaved Pussy" Deluxe Edition - They Were So Willing We Asked Them For Sex Too!

  • censoredamateurPARATHDparadise tvPARATHD-3013PARATHD3013parathd03013
    • 2020-10-23
    242 min

    [HGOT-059]快楽の中出しベスト 秘めたる欲を解放した秘密の関係4時間

  • akari neo yano tsubasa censoredcreampiebig titsHGOTk m producematsubara remonHGOT-059HGOT059h-1414hgot00059
    • 2020-11-12
    121 min

    [FSDSS-120]Momojiri's Cowgirl Squeezes All The Semen Out Of Me - Kaname Momojiri

  • kaname momojiri censoredbig titssingle workFSDSSfalenodragon nishikawafaleno starFSDSS-120FSDSS1201fsdss00120
    • 2020-11-20
    44 min

    FC2PPV 1577030 [Personal shooting] A beautiful wife of a former model is shining to repay her husband’s debt! She may not be the intention, but she was very nasty holding a male genital [Creampie]

  • amateur uncensoredfc2
    • 2020-11-24
    41 min

    Pacopacomama 112420_389 Minami Tanaka, Miki Horiguchi, Kanae Koizumi

  • minami tanaka miki horiguchi uncensoredfetishpacopacomama
    • 2020-12-01
    96 min

    451HHH-014 [Most crazy erotic terrorist] [G milk glamorous BODY] [Creampie in lust ma ● co] Pleasure fundamentalist with bottomless libido! Continuous climax of stop & go! !! Shake the huge breasts with the intense piss of peach butt thrusting an

  • amateur censoredcreampiebig titshhhhhh-014hhh014451hhh-014
    • 2020-12-08
    80 min

    1Pondo 120820_001 Emi Aoi: Emi Aoi Special Edition

  • amateur uncensored1pondo
    • 2020-12-10
    299 min

    [SVDVD-831]This Healthy P.E. Class At A Coed School Offers A High-Quality Education By Letting Boys And Girls Experience Shame By Learning How Their Bodies Are Different Through Fully Nude Lessons 5

  • hinako mori nagaregawa honami censoredcreampieschoolgirlSVDVDsadistic villageistSVDVD-831SVDVD8311svdvd00831
    • 2020-12-31
    36 min

    FC2PPV 1627331 [! New Year’s present sale! ] FG ○ Okki Hime Hajime! Cum swallowing without H & Blow out in Gachiiki by exposing her face early in the new year!

  • amateur uncensoredfc2
    • 2021-01-15
    157 min

    [PTYH-001]You've Gotta Kiss Until The Whole Candy Is Dissolved - But This Made Her So Excited She Wanted Creampie Sex!

  • censoredcreampieamateurPTYHpetersPTYH-001PTYH001h-021ptyh00001
    • 2021-01-23
    122 min

    [DASD-805]For You ALone: Shizuku Asahi, Yui Nagase

  • asahi drop yui nagase censoredcreampielesbianDASDdasrokusaburo mishimaDASD-805DASD805dasd00805
    • 2021-01-23
    135 min

    [JUL-453]It Began In The Bath - Middle-Aged Man And Woman's Passionate Love Affair - Dripping Wet With Lust Yuri Honma

  • really censoredbig titsmature womanJULmadonnahiroyuki kimuraJUL-453JUL453jul00453
    • 2021-01-24
    141 min

    [QRDA-122]Beautiful Legs - Long-Legged Mistress Teases You Sara

  • censoredQRDAqueen roadQRDA-122QRDA122qrda00122
    • 2021-01-27
    107 min

    [YAKO-022]This Miraculously Tiny Titty Lolita Babe Came And Answered Our Call, So We Gathered Everyone In The Office To Fuck Her Brains Out Shingo Mizawa # A Wannabe Idol # A Fake Interview # Yumeri

  • censoredcreampieamateurYAKOmercuryshinjuku undergroundYAKO-022YAKO022h-1133yako00022
    • 2021-01-29
    60 min

    [OTIM-055](Online Only) (Daydream POV) No Makeup Morning Sex With Your Loving Girlfriend Aoi Nakajo

  • nakagusuku censoredcreampieblowjobOTIMprestigeonetimeOTIM-055OTIM055118otim00055
    • 2021-02-07
    51 min

    FC2PPV 1676684 [Personal shooting] No.028 Kana-chan ★ G cup glamorous body again. The cute and charming girls’ etch is the best ★ [Complete appearance]

  • amateur uncensoredfc2
    • 2021-02-12
    130 min

    [DASD-816]I'll Cheat With Your No-Good Husband So You Can Divorce Him - 3-Star Agent Slut Hinako Mori

  • hinako mori censoreduniformsingle workDASDdaschinpo dazaiDASD-816DASD816dasd00816
    • 2021-02-19
    101 min

    [VEC-466]Just The Two Of Us - All Alone With My Friend's Mother. Made To Have Creampie Sex With A MILF... Shion Sato

  • sato white sound censoredcreampiebig titsVECvenussarumegami venusVEC-466VEC466vec00466
    • 2021-02-19
    123 min

    [BKD-257]Stepmom/Stepson (The Road To Western Nikko) Nao Nakano

  • nanao nakano censoredcreampiemature womanBKDrubyshakojijourneyBKD-257BKD257bkd00257
    • 2021-02-22
    73 min

    [SLRO-006]A Hostess I Met In Nagasaki Puts On A Show Barely Dressed! Himeka Saotome

  • amateur censoredbig titsbeautiful girlSLROcraneSLRO-006SLRO006
    • 2021-02-25
    225 min

    [SW-759]I Became a Teacher In Order To Have Sex With Cute Female S*****ts! 14

  • censoredbig titsschoolgirlSWswitchswitch switchSW-759SW7591sw00759
    • 2021-03-18
    45 min

    FC2PPV 1731430 [Amateur individual shooting] It was the best time to meet a blame-loving slut on a dating app. There is a second round of raw squirrel [Supporting personal shooting [No.48]] [Review privilege: Another angle]

  • amateur uncensoredfc2
    • 2021-03-19
    104 min

    [VENX-018]Clan G*******ging Sex A Pretty Auntie Aya Shiomi

  • aya shiomi censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-018VENX018venx00018
    • 2021-03-20
    49 min

    494SIKA-061 SEX Video Of Big Tits Girlfriend And Hentai Boyfriend

  • amateur censoredbig titsamateursikasika-061sika061494sika-061
    • 2021-04-09
    122 min

    [DASD-846]I Love My Stepbrother So Much I Want To Tie Him Up And Make Him Give Me My Creampie Mone Kono

  • mone kamishiraishi censoredcreampieslutDASDdaskitchomDASD-846DASD846dasd00846
    • 2021-04-09
    230 min

    [PARATHD-3166]Will Masseuses At Business Hotels Around The Country Let Us Fuck Them？ 4 Hour Special (4) ~ Aomori / Morioka / Fukui / Kanezawa / Shinyokohama / Hamamatsu Version

  • censoredbig titsPARATHDparadise tvPARATHD-3166PARATHD3166parathd03166
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-13
    20 min

    HEYZO 2520 Erotic Massage for Reina – Reina Shiraishi

  • amateur uncensoredblowjobheyzo
    • 2021-05-13
    75 min

    326URF-062 [Back Customs x Libido Monster Banker] "Deliher is a vocation ♪" A neat and clean beauty who has a hobby of saving money in a hard profession is a customs part-time job to diverge SEX desire! It’s too unequaled and 4 shots are

  • amateur censoredcreampiebig titsurfurf-062urf062326urf-062
    • 2021-06-12
    119 min

    [NASH-523]Congrats On Her 60th Birthday! The Bubble Economy, The Recession, The Tsunami... Mature Cougar Born In 1961 Has Survived The Ups And Downs Of Life... And Now She's Horny

  • censoredmature womanNASHnadeshikoNASH-523NASH523nash00523
    • 2021-06-20
    242 min

    [NASH-524]My Wife's Mother I Prefer My Mother-In-Law... Forbidden Sexual Adulterous Family Relations

  • rikako oikawa madoka kase censoredmature womanNASHnadeshikoNASH-524NASH524nash00524
    • 2021-07-02
    112 min

    [ARM-992]Complete CFNM Man Tied Up Completely Naked Gets His Nipples Licked And Sucked Until They're Totally Soaked Through

  • yuno kaname maze mahina censoredhandjobARMaroma planningshigeo kadowakiaromaARM-992ARM992arm00992
    • 2021-07-06
    47 min

    FC2PPV 1886884 [Personal shooting] Tomohame! I took a gonzo like a friend ☆ Yurie 36 years old ☆

  • amateur uncensoredfc2
    • 2021-07-10
    130 min

    [BADA-017]Married Woman Masochist Training Club Akari Niimura

  • akari shinmura censoredsingle workbukkakeBADAbaltanusubashisuidiamondBADA-017BADA017bada00017
    • 2021-07-15
    120 min

    [ZEX-406]Miraculous Transparency 2021 REMAKE - 9 Years Since Her First AV Debut Sold 10,000 Copies!! Mikako Abe 27 Years Old

  • abe mikako censoreduniformZEXpeters maxZEX-406ZEX406h-720zex00406
    • 2021-07-17
    117 min

    [DASD-895]My Girlfriend Was Taken By My Neighbor. "The Older Man Is Sensitive To Sounds And Came To Complain About The Noise Coming Through The Walls" - Arisu Nanase

  • alice nanase censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-895DASD895dasd00895
    • 2021-07-24
    87 min

    300MAAN-678 [Over 500 Cuteness! !! Beautiful Legs X Knee Socks Sex] Overwhelmingly Transparent And Overwhelming Beautiful Girl Helps Her Graduate From Virginity At The Request Of Her Boyfriend! !! Suction Blow & Best Fucking From S Plenty Of Word

  • amateur censoredcreampieamateurmaanmaan-678maan678300maan-678
    • 2021-07-30
    228 min

    [HUNTB-067]"Step-brother, are you hard？" My first experience with my step-sister who stole my virginity and semen...

  • censoredcreampiesisterHUNTBhunterborubo nakanohhh groupHUNTB-067HUNTB067huntb00067
    • 2021-08-06
    58 min

    230OREC-835 Hot Spring Slut Private College Student HRS

  • amateur censoredcreampieamateurorecorec-835orec835230orec-835
    • 2021-08-14
    119 min

    [HALE-006]Mom Friend Hunting, Infinite Loop Vol. 6, Lilia Masochist Swallowing Gal Mommy Climax LUSH

  • censoredamateurHALEhalentino mousouzokuhalentinomamatomo kui mugen loopHALE-006HALE006hale00006
    • 2021-08-17
    45 min

    FC2PPV 2039256 Overwhelming [Uncensored] A Long-Sought Reunion Date With A Beautiful Girl Who Played The Role Of A Former Child. Continuous Vaginal Cum Shot At Home … Crossing The Line

  • amateur uncensoredfc2
    • 2021-09-04
    29 min

    FC2PPV 2147803 Now It’s A Vivid And Realistic Etch Of A General Man With Big Breasts And A General Girl With Big Breasts ♥ №73 ♥

  • amateur uncensoredfc2
    • 2021-09-10
    157 min

    [BBAN-342]My Manager Is A Big Tits Nipple Teasing Lesbian. A Big Tits New Company Hire Who Climaxes From Her Manager"s Countless Intensive Nipple Teasing Nenne Ui Yuria Yoshine

  • first love yoshine yuria censoredbig titslesbianBBANbibianBBAN-342BBAN342bban00342
    • 2021-09-16
    21 min

    HEYZO 2610 A Titty Fuck with Kokoro – Kokoro

  • kokoro uncensoredblowjobcumshotheyzo
    • 2021-09-17
    74 min

    529STCV-014 Mikako-Chan (18)

  • amateur censoredcreampieschoolgirlstcvstcv-014stcv014529stcv-014
    • 2021-09-19
    63 min

    526DHT-0155 Looks Excellent Personality Style Big Breasts Girl Rika 20 Years Old

  • amateur censoredbig titsamateurdhtdht-0155dht0155526dht-0155
    • 2021-09-24
    90 min

    374IMGN-026 Mimi

  • amateur censoredcreampiebig titsimgnimgn-026imgn026374imgn-026
    • 2021-10-08
    18 min

    FC2PPV 2313523 500 Yen! 2 Shots Of Semen Cum Swallowing Without Blowjob! A Girl Who Will Do Her Best In Ng Play If You Ask ♪ Dedicated Play With A Smile Even If You Are Not Good At It! Iroha-Chan Chapter 3 _ Bonus

  • amateur uncensoredfc2
    • 2021-10-09
    57 min

    FC2PPV 2320858 Exposed Memorial [Individual] Let Your Husband Take A Picture And Show You The Reality That Others Will Conceive In Two Visits

  • amateur uncensoredfc2
    • 2021-10-09
    129 min

    [DNJR-060]Urethral Violation School

  • ichika matsumoto rina takase censoredsluthandjobDNJRinu mousozokunikukuso tei haramiDNJR-060DNJR060dnjr00060
    • 2021-10-09
    124 min

    [APAK-202]Beautiful Married English Teacher Gets Invited To A Love Hotel By Her Top S*****t And Has Rough Sex, Starring Rika Sakurada

  • rika sakurada censoredcreampieblowjobAPAKaurora project annexrkAPAK-202APAK202apak00202
    • 2021-10-12
    117 min

    [KTRA-333]Creampie In My Stepsister"s Unused Pussy - Mai Hanakari

  • flower hunting censoredcreampieschoolgirlKTRAke toraibuk tribeKTRA-333KTRA333h-094ktra00333
    • 2021-10-12
    61 min

    SIRO-4662 [First Shot] [Baby Face X Huge Breasts] [Titty Fuck Service] A Jd With Huge Breasts Who Works At A Maid Cafe Has Appeared. A Baby-Faced, Anime-Voiced Girl Shakes Her Huge Breasts Like Her Pendulum, Spinning Shy But Nasty Words. AV Applicati

  • amateur censoredbig titsamateursirosiro-4662siro4662siro-4662
    • 2021-11-01
    55 min

    328HMDN-423 [Meat Bullet M Cup] Newly Married Plump Whip Big Breasts Married Woman 26 Years Old Working At A Supermarket. Saffle Store Manager’S Demon Cock Blows Boobs Plumply And Blows Gangimari Flesh Fuck [Creampie Guess Affair Outflow]

  • amateur censoredcreampiebig titshmdnhmdn-423hmdn423328hmdn-423
    • 2021-11-05
    167 min

    [HODV-21626]Married Woman - Picking Up Girls. Celebrity Wife"s First-ever Soapland Fucking Experience. Dripping Hot Mat Sex With Lotion All Over, Escalating To Slippery Wild Sex.

  • censoredbig titsHODVh m pHODV-21626HODV216265642hodv21626



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored