nine 009




FC2NACXAUKGMILKPREDDASDMVSDPPPDDTTFSDSSBLKSQTEHODVSSISNGODDASDBBANWANZKSBJGVHMEYD

2020-09-12
165 min

[EBOD-763]"But I Love To Fuck" Super Cute Clothing Store Cashier With Big Tits And Beautiful White Skin - 19-Year-Old Kanon Ibuki's Porn Debut

  • kanobuki censoredbig titssquirtingEBODe bodytrendy yamaguchiEBOD-763EBOD763ebod00763
    • 2020-09-18
    132 min

    [BIJN-185]The Documentary Basic Instinct Baring Orgasmic Sex A Voluptuous And Meaty Perverted Young Wife Manami Oura

  • manami oura censoredcreampiebig titsBIJNbijin majo emmanuelleBIJN-185BIJN185bijn00185
    • 2020-09-25
    235 min

    [BAZX-249]I Had Sex With A Beautiful Office Lady Who's Making Money On The Side During Her Lunch Breaks With Pay-For-Play Sex, And I Have The Creampie Raw Footage To Prove It

  • censoredcreampieBAZXbazookatetBAZX-249BAZX249h-1496bazx00249
    • 2020-09-27
    58 min

    [tkwa-114]あみ＆もね

  • amateur censoredcreampieuniformtkwatkwa-114tkwa114tkwa-114
    • 2020-10-17
    213 min

    [ROYD-026]Giving Into The Temptation Of My C***dhood Friend Who Now Has Big Tits Messed-Up Vaginal Cumshot Sex with Sana Yotsuba

  • sana yotsuba censoredcreampiebig titsROYDroyalkawajirihhh groupROYD-026ROYD026royd00026
    • 2020-11-01
    235 min

    [ARAN-008]An Orgasmic Sexual Beast, Called A Married Woman A Picture Scroll Of Cruel, Orgasmic, Ripe Honey Pot Pleasure These Pieces Of Prey Are Crying Insane Tears Of Tantalizing Ecstasy As They Await Execution INFERNO BABE ULTRA FILM

  • censoredbdsmARANbabyentertainmentshiroto musume kyoso kyokuARAN-008ARAN008aran00008
    • 2020-11-11
    98 min

    [EMOI-035]Emo Girl / Begging For A Creampie In The Cum Dungeon / Remote-Controlled Egg Vibrator Training / Nude In Abandoned Building / Blowjob In The Car / Tall Girl, 168 cm / Mugi Honjo (20)

  • barley censoredcreampieamateurEMOIsod createcomet akaiemo girlEMOI-035EMOI0351emoi00035
    • 2020-11-22
    88 min

    300NTK-473 I found a demon milk I cup beauty! !! A beautiful wife of a non-standard beauty cosmetologist who came by handing a pick-up! !! Demonstration of enthusiastic oil application of boobs rushing is inevitable erection! !! Fluffy fluffy love ra

  • amateur censoredcreampiebig titsntkntk-473ntk473300ntk-473
    • 2020-11-23
    167 min

    [CESD-948]AV Document: Chiharu Miyazawa's All-Day Full-Out Partying!

  • chiharu miyazawa censoredcreampiemature womanCESDceleb no tomoCESD-948CESD948cesd00948
    • 2020-11-26
    85 min

    AVKH-186 Kurokawa Sarina

  • amateur censoredamateurblowjobavkhavkh-186avkh186avkh-186
    • 2020-12-01
    56 min

    DIZ-009 Kana

  • amateur censoredcreampieamateurdizdiz-009diz009diz-009
    • 2020-12-10
    130 min

    [MEKO-198]Married Woman Who Took A High Paying Part Time Job As A Nude Art Model Fucked And Filled With Cum 31

  • censoredcreampieamateurMEKOmilf laboMEKO-198MEKO198h-1160meko00198
    • 2020-12-16
    57 min

    FC2PPV 1607675 First Leak of famous cartoonist

  • amateur uncensoredfc2
    • 2020-12-21
    107 min

    [DUVV-031]We Discovered This Music S*****t In Akita, And Now She's Making Her Pregnant Adult Video Debut Ichika Hasumi

  • hasumi ichika censoredcreampiebig titsDUVVtoyohikotoyohikotoyohiko planningDUVV-031DUVV031duvv00031
    • 2021-01-02
    122 min

    [UMD-763]What？! My Friend's Girlfriend Is Hiding In My Bed？! - "Do You Want To Have Sex With Me？ Nobody Can See Us If We Do It Between The Sheets..." 3

  • inaba rumi tadami censoredbig titsUMDleodragon nishikawaUMD-763UMD763125umd00763
    • 2021-01-10
    57 min

    FC2PPV 1639055 [First shot] Blow lover Kirara and raw squirrel cum shot SEX

  • amateur uncensoredfc2
    • 2021-02-01
    124 min

    [DROP-056]Amateur Girls With The Best Blowjob SK**ls!! 7

  • censoredamateurblowjobDROPoffice k sDROP-056DROP05636drop00056
    • 2021-02-04
    64 min

    336KNB-140 I want money to build a house and apply for AV! A sexually active wife who is not satisfied with having sex with her husband every day is urged by a crazy look. I will take a gonzo with this married woman from now on. 35 at Negishi Station

  • amateur censoredbig titsmarried womanknbknb-140knb140336knb-140
    • 2021-02-05
    142 min

    [HODV-21546]"I Know You're About To Cum, But I'm Not Going To Stop What I'm Doing, Okay？" Follow-Up Whispering Dirty Talk Pull Out Sexual Teasing That Will Get You To Ejaculate Over And Over Again Tsubasa Hachino

  • yano tsubasa censoredslutsingle workHODVh m pk c takedaHODV-21546HODV215465642hodv21546
    • 2021-03-12
    109 min

    [PAKO-032]Tall Big Titted Married Woman At The Pachinko Parlor

  • censoredbig titsamateurPAKOmercuryold lady fucking cafeteriaPAKO-032PAKO032h-1133pako00032
    • 2021-03-20
    244 min

    [SGKX-001]Cut Girl Gram #001 (Hopping From One Girl To Another Documentary)

  • censoredbig titsSGKXhame chanhajime yanaigal suta gramSGKX-001SGKX001h-1575sgkx00001
    • 2021-04-02
    117 min

    [ARM-965]A Super Massive Oil Massage x "That's A Good Boy, That's A Good Boy ..." Cock Tip Stimulating Pleasure Chapter 2 2

  • hebei haruna ichinose love censoredhandjobARMaroma planningshigeo kadowakiaromaARM-965ARM965arm00965
    • 2021-04-06
    140 min

    [STARS-351]Aphrodisiac + Slender Body + Hard Fucking Girl Gets Fucked And Cums So Hard She Loses Her Mind And Pisses Everywhere! Aphrodisiac Sex Climax! Hikari Aozora

  • hikari aozora censoredsquirtingsingle workSTARSsod createkaorusod starSTARS-351STARS3511stars00351
    • 2021-04-09
    145 min

    [SKMJ-158]Slip Your Dick Into This Big Ass Sch**lgirl From Behind For Some Quickie Action! This Beautiful Y********l In Uniform Works Part-Time At A Housecleaning Service And When She Came To Your House You Couldn't Resist The Temptation Of Her M

  • censoredcreampiebig titsSKMJred face girlswing nagaseSKMJ-158SKMJ158h-1324skmj00158
    • 2021-04-14
    151 min

    Caribbeancom 041421-001 Female Teacher Anthology Eri Hosaka, Tomomi Motozawa, Yui Hatano, Yayoi, Maho Sawai

  • eri hosaka uncensoredcreampiehandjobcaribbeancom
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    126 min

    [NACR-421]The Beautiful Wife Next Door She Accidentally Enters The Wrong House After Partying Akari Niimura

  • akari shinmura censoredbig titsslutNACRplanet plusdirector onanakuruNACR-421NACR421h-237nacr00421
    • 2021-05-02
    128 min

    [KAGP-182]Passionate French Kisses With Two Friendly Amateur Girls Leads To A Teasing Handjob 4 12 Girls

  • censoredamateurhandjobKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-182KAGP182kagp00182
    • 2021-05-02
    125 min

    [ARMF-016]Complete S********l Picture Book Volume 1

  • tsubaki rika hazuki peach censoredanalschoolgirlARMFaroma planningfemale body fetishismARMF-016ARMF016armf00016
    • 2021-05-20
    120 min

    [NXG-362]Traveling Saleswoman Sells Men's Underwear And Sex Toys Carefully Selected Beautiful Women Special Collection

  • censoredbig titsblowjobNXGstar paradisenext groupNXG-362NXG362h-254nxg00362
    • 2021-05-21
    28 min

    FC2PPV 1829598 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] God body rookie gravure ♥ ️ tall beautiful legs beautiful breasts perfect ♥ ️ mass cum shot! !! ♥ ️ * Review benefits / High quality Ver

  • amateur uncensoredfc2
    • 2021-05-23
    29 min

    FC2PPV 1832698 [Uncensored] Limited time offer !! Super neat !! Super beautiful and super beautiful legs Nagusho wet shaved nursery teacher and continuous squirrel (Part 1)

  • amateur uncensoredfc2
    • 2021-06-05
    240 min

    [MMB-369]Ultimate Service By A Beautiful Hostess! Welcome To The Raw Sex Japanese Inn!

  • mai hebei melody mark censoredcreampieMMBmomotaro video publishingdr ishikiri bridgemomotaro bestMMB-369MMB369mmb00369
    • 2021-06-06
    118 min

    300MIUM-719 [Face, gesture, body shape … everything is erotic cute] Looks Super idol class horse meat shop part-time job girl is rented as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persua

  • amateur censoredcreampieamateurmiummium-719mium719300mium-719
    • 2021-06-20
    125 min

    [NDWQ-011]Deepthroat Demon Breaking In: Female Body Reverse Fluid Injection Edition - Makoto Kawagoe

  • makoto kawagoe censoredcreampiesquirtingNDWQtoyohikozarakiseiunkai ekusutorimuNDWQ-011NDWQ011ndwq00011
    • 2021-06-25
    54 min

    FC2PPV 1888200 [Personal shooting] Immature beautiful young wife and affair Enko! Excited by the female genitals of bristles and vaginal cum shot [Amateur Gonzo]

  • amateur uncensoredfc2
    • 2021-07-02
    79 min

    518ASGM-009 [Sleep Fucking / Intravaginal Ejaculation] Shinagawa Ward Glasses Beautiful Girl Hidden Camera (Tokyo / International Studies) Estimated F Cup

  • amateur censoredcreampiebig titsasgmasgm-009asgm009518asgm-009
    • 2021-07-09
    54 min

    FC2PPV 1913271 [No / piece] Small devil maid advent! I’ll pour semen into my mouth to thank you for making me feel good with a smile ♡ * There is a face-up review privilege

  • amateur uncensoredfc2
    • 2021-07-12
    68 min

    FC2PPV 1917609 Reunited with a teenage runaway girl. Makeup and favorite clothes helped by her mother fuel her sense of immorality. A large amount of thick semen is vaginal cum shot in her pussy during the wet development of a pure girl.

  • amateur uncensoredfc2
    • 2021-07-28
    420 min

    GWDOM-002 [Sale For A Limited Time] [Mgs Exclusive Distribution Best] Demon Harassment For Beautiful Office Ladies. Working De M 16 People 420 Minutes

  • amateur censoredamateurgwdomgwdom-002gwdom002gwdom-002
    • 2021-08-01
    120 min

    [NACR-447]部長の嫁に誘惑されて 堀内未果子

  • mikako horiuchi censoredcreampieslutNACRplanet plussakura ninshichi ku ryuuNACR-447NACR447h-237nacr00447
    • 2021-08-20
    150 min

    [CJOD-309]Librarian Girl Talks Dirty While Having Sopping Wet Raw Cowgirl Sex, Starring Yuu Kawakami

  • yu kawakami morino morino censoredcreampiesingle workCJODbisapporo tarouchijo hebunCJOD-309CJOD309cjod00309
    • 2021-08-20
    51 min

    FC2PPV 2050617 Men’s Esthetic Training Hidden Shooting (Karen 24 Years Old) -Silver ● Slowly Attack An Elegant Fair-Skinned Beauty Nail Technician Who Works At A Luxury Salon With A Hand Man And Insert It Raw Into A Sloppy Maco

  • amateur uncensoredfc2
    • 2021-09-08
    71 min

    533NNS-003 Miraculous Chubby Beautiful Girl! !! Matching G Cup And Beautiful Woman With High Facial Deviation Value! !! A Photo Session Leaked Safely With Continuous Vaginal Cum Shot! !!

  • amateur censoredcreampiebig titsnnsnns-003nns003533nns-003
    • 2021-09-18
    86 min

    FC2PPV 2217618 Crying! !! Tears. "Genuine Amateur" "Genuine Tears" Foreign-Affiliated Cosmetics Salesperson, "Tears Porori" Lori Beautiful Amateur Beauty S ○ X Begins To Cry, And Even If She Is Crying, She Cums Inside The Bea

  • amateur uncensoredfc2
    • 2021-10-07
    125 min

    [DLDSS-032]My Father-in-Law Gives Me a Creampie Every Night. Ayaka Tomoda

  • ayaka tomoda censoredcreampiedeepthroatDLDSSdahliasaigou shouDLDSS-032DLDSS0321dldss00032
    • 2021-10-08
    140 min

    [IPX-748]After School Taboo: Immoral French Kisses and Sex Between a Female Teacher and Her S*****t, Tsumugi Akari

  • akari tsumugi censoredcreampiesingle workIPXidea pockettissueIPX-748IPX748ipx00748
    • 2021-10-16
    140 min

    [TIKB-123](Diary Of Fucking) Manami Oura Gets Super Slutty After Guzzling A Few While Partying, Now She"s Ready For Full-on POV Fucking!

  • manami oura censoredbig titssingle workTIKBchikichikiba gu mousozokuTIKB-123TIKB123tikb00123
    • 2021-10-16
    110 min

    [BIJN-209]THE Document Bare Instinctive Climax Cum SEX Tall Bitch GAL Nasty Creampie Mad Climax Isshiki Ayaba

  • isshiki ayaba censoredcreampiesingle workBIJNbijin majoBIJN-209BIJN209bijn00209
    • 2021-10-18
    58 min

    INTE-004 Yuuki-Chan (Erina Oka)

  • amateur censoredamateurblowjobinteinte-004inte004inte-004
    • 2021-10-21
    125 min

    [HAVD-1013]Hot Smothering Kisses! Horny Best Friend Lesbian Series - Endless Horny Raw Lesbian Sex

  • kagami sara mahiro ichiki censoredlesbianHAVDhibinodr torihamaHAVD-1013HAVD10131havd01013
    • 2021-10-23
    241 min

    [SGSR-288]Really!？ AV - Shocking Situation That Actually Happened. She Witnesses A Crucial Moment! Step-mom Cheats On Her Husband With Her Step-son. Raw Fucking With Boss"s Daughter. Neighborhood Wife Stars In An AV. She Shows Off Hot Sex To Her

  • censoredcreampiebig titsSGSRbigmorkalsakaegyou chuushin sen kumiSGSR-288SGSR28857sgsr00288
    • 2021-10-23
    120 min

    [SNKH-014]プリケツ美人OLは黒人さんとヤリたい！ デカい男を犯し犯●れたいおねえさんが黒マラでハメ潮イキ 桐山結羽

  • kiriyama yuu censoredsquirtingsingle workSNKHsharksnarkhoodSNKH-014SNKH014h-687snkh00014
    • 2021-10-25
    59 min

    541AKYB-038 Megu (24) Pursuit Blow From Creampie To National Treasure Class G Breast Girl (Megu Mizumori)

  • amateur censoredcreampiebig titsakybakyb-038akyb038541akyb-038
    • 2021-11-04
    69 min

    FCP-051 [Delivery Only] Completely Subjective! !! G Cup Or More That Completely Wraps Ji ● Ko … Superb Big Tits Fucking ＃ 5 (Saeko Hiiragi, Leona Fujisaki, Kanon Ibuki)

  • amateur censoredbig titsamateurfcpfcp-051fcp051fcp-051
    • 2021-11-04
    63 min

    230OREC-922 Miso (Suwon Miso)

  • amateur censoredbig titsamateurorecorec-922orec922230orec-922



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored