o paradise




FC2NGODKBICJODPPPDADNJUFEHUNTBSANHMNMILKSHKDFSDSSDASDHDKADTTMIDEWAAAMIDVGVHAUKS

2020-10-24
146 min

[DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-25
    63 min

    413INST-064 Mikan, 18 years old, attending a girls’ school! My first experience is a school teacher ♪ I love Ojisan JD! 1L squirting with fingering! Don’t miss the too beautiful Ahegao and butt! Surprising Smile Cleaning Blow

  • amateur censoredamateurslutinstinst-064inst064413inst-064
    • 2020-10-31
    59 min

    1Pondo 103120_001 My Best Friend’s Girl Friend: Minori Kawahara

  • amateur uncensored1pondo
    • 2020-11-18
    57 min

    [NYH-058]I Saw A Married Woman's Panties On My Apartment Building's Stairs! My First Experiences With A MILF While My Mother Was Away Kana Morisawa

  • kana morisawa kanako iioka censoredmarried womanslutNYHdirectorsdirectorsnyanjiang houseNYH-058NYH0581nyh00058
    • 2020-11-24
    140 min

    [SDAB-154]Youthful Getaway - Fair-Skinned Beautiful Girl Spends A Summer Day Slaking Her Lust: Cum Swallowing/Fucking In The Open Air/As Hard As She Can, Seeking Pleasure With Her Whole Body Chika Sato

  • chika sato censoredschoolgirlbeautiful girlSDABsod createkisshione s youthSDAB-154SDAB1541sdab00154
    • 2020-12-05
    59 min

    383REIW-025 Sarina

  • amateur censoredcreampiebig titsreiwreiw-025reiw025383reiw-025
    • 2020-12-08
    82 min

    300NTK-469 Visit the hospital to find out what the cause and effect of 170cm beauty G milk OL is! !! The iron plate that I was born with is a raw spit! !! Even a dirty metamorphosis practitioner forgets the preciousness of loving beautiful limbs! !!

  • amateur censoredbig titsamateurntkntk-469ntk469300ntk-469
    • 2020-12-19
    44 min

    FC2PPV 1612427 [Individual shooting 28] Prefectural K ③ Active model Shaved ⑬ Outdoor exposure and vaginal cum shot !!

  • amateur uncensoredfc2
    • 2020-12-21
    16 min

    10musume 122120_02 Secret Pussy Collection: Hitomi Ikeda

  • amateur uncensored10musume
    • 2021-01-16
    118 min

    [PPPD-900]Twin Sluts Surround A Hung Older Guy And Drain His Sperm Bank Dry! Tanned, Busty Nymphos Use Their Bondage SK**ls

  • censoredcreampiebig titsPPPDoppaiPPPD-900PPPD900pppd00900
    • 2021-01-22
    91 min

    [PITV-023]Sexy Nakedness - Honoka Kadowaki

  • kadowaki honohana censoredbig titsbeautiful girlPITVpistilPITV-023PITV0235581pitv00023
    • 2021-01-23
    239 min

    [MCSR-425]Sudden Surreptitious Finger-Banging! 2 - Knowingly Or Not, Two MILFs Go To A Pick-Up Bar For Liquor And Ended Up Getting Fucked 6 Pairs, 12 Mature Girls, 4 Hours

  • censoredmature womanMCSRbig morkalfinger banging naughty taromascottMCSR-425MCSR42557mcsr00425
    • 2021-01-24
    129 min

    [AVSA-154]Wild Nympho With Huge Tits Craves A G*******g Hana Himesaki

  • himesaki hana censoredcreampiebig titsAVSAavs collector sbuddha davscollector sAVSA-154AVSA154avsa00154
    • 2021-02-11
    54 min

    FC2PPV 1681410 First shot ❤️ Get a big tits slender white-skinned natural girl with TikTok! Cheating Dick Raw Saddle SEX While Calling With Boyfriend → Unauthorized Seeding In The Vagina As It Is Massive Creampie! [Personal shooting] With benefits

  • amateur uncensoredfc2
    • 2021-02-12
    120 min

    [MDTM-704]First Time Having Sex With You - Ichika Kurokawa, Fresh Face, First Shots. AV Debut

  • kurokawa kazuhana censoredcreampieuniformMDTMuchu kikakutodoMDTM-704MDTM704h-585mdtm00704
    • 2021-02-16
    63 min

    FC2PPV 1689070 ★ First shot amateur ☆ Large screaming ♥ Muramura lust BODY ♥ Local active OL Tsubaki-chan 25 years old ☆ Glossy erotic BODY ♥ Sensitive electric maiki ♥ Rich raw squirrel screaming screaming cum shot sex ♥ [Personal shooting] * With b

  • amateur uncensoredfc2
    • 2021-02-19
    126 min

    [AEG-012]Outdoors S&M: Exhibitionist Education - Kanon Mira VS Kurumi Mira

  • censoredbdsmAEGprestigehideki hormonaegean prestigeAEG-012AEG012118aeg00012
    • 2021-02-21
    48 min

    FC2PPV 1695887 [Individual shooting] Connected with the simple Aniota J system of beautiful breasts

  • amateur uncensoredfc2
    • 2021-03-05
    115 min

    [PARATHD-3124]A Wife With Big Tits Who Was Continuously Fucked By Her Father-in-law, Whom She Hates, For 3 Days While Her Husband Was Away On A Business Trip

  • censoredcreampiebig titsPARATHDparadise tvPARATHD-3124PARATHD3124parathd03124
    • 2021-03-09
    49 min

    FC2PPV 1719198 * Limited time 3980⇒2980pt ★ Super rare amateur ☆ Lori girl Mayatan 19 years old re-advents in a nasty maid! ☆ Decaprickets are addictive ♥ Electric Maiki ♥ Rich intense blowjob ♥ Gun thrusting into the finest pussy ♥ [Personal shootin

  • amateur uncensoredfc2
    • 2021-03-19
    59 min

    402MNTJ-047 Salina (23)

  • amateur censoredbig titsamateurmntjmntj-047mntj047402mntj-047
    • 2021-03-20
    116 min

    [OFKU-176]How Do I Have Sex With The Beautiful Married Woman With Hot Legs Who Lives In The Same Apartment Complex As Me And Is Always Emitting Pheremones？ Yuri Tadokoro 38 Years Old

  • yuri tadokoro censoredcreampiemature womanOFKUstar paradisemom railOFKU-176OFKU176h-254ofku00176
    • 2021-03-25
    120 min

    [013ONEZ-280]【完全主観】あざと可愛いお下品変態メイドさんはお好きですか？成田つむぎ

  • amateur censoredcreampieamateuronezonez-280onez280013onez-280
    • 2021-04-06
    101 min

    229SCUTE-1112 Ami (22) S-Cute Lolita wants to be stabbed in the back

  • amateur censoredbig titsuniformscutescute-1112scute1112229scute-1112
    • 2021-04-14
    186 min

    [PPPD-916]High Grade Nympho Club Escort With Big Tits And The Highest Return Rate For Masochistic Guests Makes Her Porn Debut Risa Dan

  • rinsha dan censoredbig titsslutPPPDoppaiPPPD-916PPPD916pppd00916
    • 2021-04-16
    115 min

    [PARATHD-3157]- Dedicated To All The People Who Couldn't Visit Their Families During The Lockdown - A Live Broadcast Of Virtual Sex With A Stepmom And Little Stepsister Who Live Back Home Complete Edition

  • yuka hirose momojiri kano censoredstepmomsisterPARATHDparadise tvPARATHD-3157PARATHD3157parathd03157
    • 2021-04-18
    61 min

    413INST-114 [God Breasts OL / Orgy Individual Shooting] Kcup Miracle Big Breasts OL-chan and Orgy SEX with Tacopa with Ai ○! Heaven fucking where dicks are buried, swaying milk is a world erotic heritage! !! [Of course, raw vaginal cum shot]

  • amateur censoredcreampiebig titsinstinst-114inst114413inst-114
    • 2021-05-06
    98 min

    [HONE-260]Soft Pressure And Squishy Squeezing! Groping My Step Mom's Titties Mako Oda

  • oda mako censoredcreampiebig titsHONEcenter villagesouthern earthhanazono center villageHONE-260HONE260h-086hone00260
    • 2021-05-07
    60 min

    230OREC-754 Rin

  • amateur censoredcreampieamateurorecorec-754orec754230orec-754
    • 2021-05-22
    238 min

    [GENS-020]

  • kataoka nagisa censoredmature womansingle workGENSgenekigoldfish dGENS-020GENS020gens00020
    • 2021-06-10
    44 min

    H0930 ki210610 Eriko Sawaki 32years old

  • amateur uncensoredh0930
    • 2021-06-12
    155 min

    [MDBK-183]A Members' Only Men's Massage Parlor Using High-class Rejuvenation Oil - Unlimited Ejaculation Service With A Beautiful Esthetician

  • scooping hamazaki mao censoredcreampiebig titsMDBKbazookak taroMDBK-183MDBK183mdbk00183
    • 2021-06-15
    120 min

    [ZEX-405]Hot And Steamy Sex Pure And Innocent Sex Pure Lesbians In A World With Only Beautiful Women OR Dark Crazy Instinctual Sex

  • yuri sugawa satomi yuria censoredbig titslesbianZEXpeters maxZEX-405ZEX405h-720zex00405
    • 2021-07-06
    94 min

    261ARA-496 [Transcendence Gal] [Absolute Beauty] Hono-chan is here! The reason for her application, who works at a hair removal salon, is "I want you to see my beautiful body ♪" I applied to show off! ？？ [Enchanted slender BODY] A dynamite bo

  • amateur censoredbig titsamateuraraara-496ara496261ara-496
    • 2021-07-22
    191 min

    [FSDSS-262]Double Little Devil Teasing You'll Get Full-Body Lip Treatment, All Licking, All The Time A Harlem Reverse Threesome Fuck Fest Ena Satsuki Meisa Kawakita

  • ena satsuki kawakita meisa censoredbeautiful girlslutFSDSSfalenokicchomufaleno starFSDSS-262FSDSS2621fsdss00262
    • 2021-08-13
    240 min

    [PPBD-217]My Glans Is About To Explode! A Super Masochistic Girl"s Ejaculation Management She Stops Once She"s Brought You To The Brink - BEST

  • hitomi tsujii honoka censoredcreampiebig titsPPBDoppaiPPBD-217PPBD217ppbd00217
    • 2021-08-21
    72 min

    FC2PPV 2056474 [No Individual Shooting, Beautiful Face That Can Only Be Seen Here, 〇Waves Very Similar To The Beach, Full-Scale Fetish Non-Stop 2 Consecutive Cum Swallowing That Is Too Erotic] Eimi-Chan, Who Does Not Need Explanation, Is Wearing Gym

  • amateur uncensoredfc2
    • 2021-08-26
    101 min

    [FERA-127]When He Got His First Girlfriend, This Jealous Stepmom Who Loved Her Stepson Way Too Much Felt Threatened By The Appearance Of A New Rival, And Decided To Lure Him To Creampie Temptation Inappropriate Sex To Strain The Bonds Of Love Yuka Mi

  • yuka mizuno censoredcreampiemature womanFERAcenter villageminami daichirakuen center villageFERA-127FERA127h-086fera00127
    • 2021-08-29
    43 min

    229SCUTE-1121 Mari (19) S-Cute Irama-Loving Girls’ Rich Sex

  • amateur censoredcreampiesquirtingscutescute-1121scute1121229scute-1121
    • 2021-09-10
    173 min

    [DASD-915]The Bitch"s Vulgar Fucking With Overly Gross Licking And Sucking. Akari Mitani

  • mitani akari censoredcreampieblowjobDASDdasnao masakiDASD-915DASD915dasd00915
    • 2021-09-24
    120 min

    [JUL-717]The Bathhouse Just Closed... -Steamy Sweaty Indecent Sex With A Younger Man-. Hitomi Honda

  • honda hitomi censoredbig titsmature womanJULmadonnakitorune kawaguchiJUL-717JUL717jul00717
    • 2021-09-25
    69 min

    FC2PPV 2247468 * Urgent Notice! Only For 2 Days ★ Nigoo Works Innocent Beautiful Girl ♥ Yuri-Chan 18 Years Old ♥ Limited Re-Release In Response To User’S Request! [High Image Quality And Benefits]

  • amateur uncensoredfc2
    • 2021-10-01
    122 min

    [MILK-123]Quickie, Raw Fucking, Creampie, It"s All Allowed! This Super Slutty Gal Will Happily Give Anything A Try! This Call Girl Knows How To Keep Things A Secret When Fucking! Riria Hyodo

  • riria hido censoredcreampiebeautiful girlMILKmilkMILK-123MILK123h-1240milk00123
    • 2021-10-19
    60 min

    H4610 ki211019 Chisato Kaneko 26years old

  • amateur uncensoredh4610
    • 2021-10-20
    97 min

    [DOKI-016]Stopping Time To Fuck As Much As You Want. Older Stepsister With A Curvy Figure Dressed In A Suit At Work Gets Involved With Pranks For You To Indulge In.

  • aitsuki celia rumi tadami censoredcreampiebig titsDOKIstar paradisedokiDOKI-016DOKI016h-254doki00016
    • 2021-10-22
    125 min

    [BANK-058]Busty Wife Hot Spring Date--Electrifying & Super-Sexy Model Babe With Perfect, Creamy Skin: Meet 28-Year-Old Shiori

  • censoredcreampiebig titsBANKma ko ginkouyuuseiBANK-058BANK058h-1495bank00058
    • 2021-10-28
    58 min

    FCP-049 [Distribution Only] Stared By A Naughty Older Sister, Whispered And Fired … Super Goddess Handjob ＃ 1

  • amateur censoredamateurhandjobfcpfcp-049fcp049fcp-049
    • 2021-10-29
    117 min

    [ATID-484]A Really Fat Black Dick Got Thrust Up My Ass... Chiharu Miyazawa

  • chiharu miyazawa censoredsingle workATIDattackershaga eitarouin madATID-484ATID484atid00484
    • 2021-11-02
    60 min

    230OREC-920 Yuria (Yuria Hafu)

  • amateur censoredcreampieamateurorecorec-920orec920230orec-920
    • 2021-11-04
    57 min

    230OREC-924 Chiharu (Chiharu Sakurai)

  • amateur censoredcreampieamateurorecorec-924orec924230orec-924
    • 2021-11-15
    56 min

    230OREC-933 Kazuna (Kazuna Yuki)

  • amateur censoredcreampiebig titsorecorec-933orec933230orec-933
    • 2021-11-25
    56 min

    FCP-055 [Delivery Only] You Can’t Do It Without Permission, Right？ Faint In Agony! Dimension Stop Oil Handjob! !! 4 (Rinko Naka, Chiharu Sakurai, Riria Hido)

  • amateur censoredamateurslutfcpfcp-055fcp055fcp-055
    • 2021-12-17
    120 min

    [MIAA-545]I Had A Short Time Affair With A Little Devil Part-timer In The Store In Secret. Whenever I Had A Chance, I (The Store Manager) Would Fuck Her Over And Over Again, Right Away... Hana Hakuto

  • white peach censoredcreampieschoolgirlMIAAmoodyzeveryone s porn starMIAA-545MIAA545miaa00545
    • 2021-12-17
    123 min

    [FOCS-037]They Cancelled The Fireworks Festival!？ A POV Video, Filmed During A Double Seduction Massive Squirting Kanon Kanade Sensitive, Instantly Cumming Big Tits Mizuki Yayoi The Strongest, Double Beautiful Girl Four-Way Swapping Creampie Large Or

  • kanon kanon mizuki yayoi censoredcreampiebig titsFOCSabc mousouzokufocusFOCS-037FOCS037focs00037
    • 2021-12-17
    120 min

    [MEYD-723]Our Office Is Promoting A Work-From-Home Lifestyle, And Now I"m Alone With My Horny And Totally Sexy Married Woman Lady Boss. From The Afternoon Until The Next Morning, She"s Driving Me Hard With Excessive Work And Making Me Hit A N

  • cape sakura censoredcreampieslutMEYDtameike gorokogoro kindaichiMEYD-723MEYD723meyd00723
    • 2021-12-18
    76 min

    383REIW-103 Haruna (Hina Kawai)

  • amateur censoredcreampieamateurreiwreiw-103reiw103383reiw-103



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored