pov toy creampie javcensored censored




FC2VENXSHKDABWMIAAMIDEAPODVEMAJULWAAAMARAMEYDHMNPREDDASDGVHCAWDSPRDPPPDKBIMVSD

2020-11-24
79 min

415LAS-030 Non

  • amateur censoredcreampiesquirtinglaslas-030las030415las-030
    • 2020-11-27
    230 min

    [PARATHD-3042]If My Braless Stepmom And Her Perverted Body Keeps Coming On To Me This Hard I Have No Choice But To Fuck Her: 4 Hour Special

  • censoredmature womanstepmomPARATHDparadise tvPARATHD-3042PARATHD3042parathd03042
    • 2020-12-10
    54 min

    230OREC-654 Kokomi

  • amateur censoredcreampieamateurorecorec-654orec654orec-654
    • 2020-12-18
    125 min

    [AEG-010]The Female Detective Anal Penetration Alice Toyonaka

  • alice toyonaka censoredbdsmAEGprestigehormone hidekiaegean prestigeAEG-010AEG010118aeg00010
    • 2020-12-20
    118 min

    [DASD-781]The Lover I'd Never Tell My Wife About On My Life - Overnight Creampie Cheat Tour For Anal With My Transsexual Girlfriend Yura Amatsuka

  • angel yura censoredbeautiful girlsingle workDASDdasrokusaburo mishimaDASD-781DASD781dasd00781
    • 2020-12-24
    84 min

    [IENF-116]Elegant Married Women With Big Tits Take Young Guys' Virginities! - Cherry Boys Gently Take The Lead For Their First Experiences As These Goddesses Let Themselves Get Fucked And Creampied!

  • censoredcreampiebig titsIENFienergyienfIENF-116IENF1161ienf00116
    • 2020-12-24
    122 min

    [FSDSS-146]Miss Moe Looks After Your Daily Cum Needs At Her Private Daycare Moe Amatsuka

  • angel moe censoredbeautiful girlsingle workFSDSSfalenoflagmanfaleno starFSDSS-146FSDSS1461fsdss00146
    • 2020-12-26
    67 min

    FC2PPV 1621614 ★ First shot amateur ☆ Neat and clean Alice from Spain 19 years old ☆ Super erotic girl who changes suddenly ♥ Super iki with white eyes peeled ♥ On the verge of outburst on a small devil blowjob ♥ First vaginal cum shot of apt ♥ [Pers

  • amateur uncensoredfc2
    • 2020-12-26
    140 min

    [JUKF-053]I've Always Loved You, Teacher. Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiebeautiful girlJUKFjumpjump avJUKF-053JUKF053h-227jukf00053
    • 2021-01-03
    47 min

    FC2PPV 1630188 Rikako, a Roppongi lounge girl who was deceived by a massage recruitment and abandoned her pride ❤️ Raw squirrel to a slender beauty who stays high ❤️ A sticky villa villa that was used in the pillow business There is a purchase privil

  • amateur uncensoredfc2
    • 2021-01-09
    120 min

    390JAC-077 [The most 17 shots in the series x Creampie bukkake barrage] A female dentist with a super lewd face and contents is coming! !! “I want to be surrounded by penises and bukkake …” It’s a festive ruckus with continuous In

  • amateur censoredcreampiesquirtingjacjac-077jac077390jac-077
    • 2021-02-16
    130 min

    [MSFH-050]When The Attendance Rate At The Office Plummeted, I Found Myself Alone With My Lady Boss ... And When She Realized That My Pants Were Bulging (I'm A Cherry Boy), She Lured Me To Creampie Sex, And We Ended Up Fucking Like Crazy Until My

  • rio hirose censoredcreampiesingle workMSFHsod createkirinms sodMSFH-050MSFH0501msfh00050
    • 2021-02-26
    64 min

    [ello-001]ももchan(20)

  • amateur censoreduniformamateurelloello-001ello001ello-001
    • 2021-02-26
    44 min

    Caribbeancom 022621-001 Naughty Woman : Rena

  • rena uncensoredhandjobcaribbeancom
    • 2021-03-06
    139 min

    [SHKD-934]This Is The Special Day On Which I Finally Get To Fuck The Stepdaughter I Lovingly Raised Since She Was Young. Akari Neo

  • akari neo censoreduniformbeautiful girlSHKDattackerssharkSHKD-934SHKD934shkd00934
    • 2021-03-12
    160 min

    [ZMEN-081]My Friend's Girlfriend Slipped Into My Bed During A Sleepover... 6 Unable To Resist The Pheremones From This Lusty Older Woman I Cover Her Mouth With Mine To Stifle The Sound Of Her Cumming As I Fuck Her Over And Over!

  • really aishin shinkawa censoredblowjobZMENz mennaveZMEN-081ZMEN081h-1371zmen00081
    • 2021-03-20
    61 min

    HEYZO 2481 Masochistic Slut -Married Bitch Giving Her Husband The Cold Shoulder- – Rena

  • rena uncensoredcreampieheyzo
    • 2021-04-01
    36 min

    FC2PPV 1750481 [Personal shooting] ♀206 Female college student Me ◯ -chan 19 years old 7th time Pregnancy AV shooting training started for the second time without being disappointed in the fall ◯! (LOL)

  • amateur uncensoredfc2
    • 2021-04-16
    54 min

    FC2PPV 1773301 [Uncensored] When I met him for the first time in a long time, he turned into a super popular hostess, but Ji ● Po addiction does not heal Former J ● Refre Miss hostess: Mai (19 years old)

  • amateur uncensoredfc2
    • 2021-04-23
    57 min

    345SIMM-637 [Gonzo with my sister who makes my brother sex ●●] My sister who plays with my body almost every day makes me a toy today … Creampie 3 times at her home! !! !!

  • amateur censoredcreampieamateursimmsimm-637simm637345simm-637
    • 2021-04-25
    63 min

    FC2PPV 1786836 [Top secret video] [Leaked] Active H cup huge breasts gravure college days before debut Individual shooting Gonzo video leaked Creampie (leaked Gonzo data)

  • amateur uncensoredfc2
    • 2021-04-26
    48 min

    492JCHA-035 There is no reason why JK taken in erotic videos is naive! Four

  • amateur censoreduniformschoolgirljchajcha-035jcha035492jcha-035
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    54 min

    [hint-0451]あいら(30)

  • amateur censoredcreampiemilfhinthint-0451hint0451hint-0451
    • 2021-05-24
    47 min

    FC2PPV 1834656 [Personal shooting, vaginal cum shot, pt off for a limited time] 33-year-old child and wife, who should have rubber, could not stand being rubbed with raw cock and accepted raw insertion …

  • amateur uncensoredfc2
    • 2021-06-04
    119 min

    [SHKD-950]Call Girl Meets Her Most Hated Teacher Again When He Hires Her. He Makes Her Do The Deed Raw, And She Winds Up Knocked Up With His Loathsome Seed. Tsumugi Akari

  • akari tsumugi censoredbeautiful girlsingle workSHKDattackersjo stylesharkSHKD-950SHKD950shkd00950
    • 2021-06-12
    121 min

    [VEO-043]Real Married Amateur's Porn Debut! She Lures Customers To Her Cafe With Her Big Tits And Big Booty - She's So Prim, Pretty, And Cute You'd Never Expect She Loves To Gobble Cock - Barista Married For 7 Years, Chiharu Ito

  • chiharu ito censoredcreampiebig titsVEOvenuspeterbornVEO-043VEO043veo00043
    • 2021-06-12
    117 min

    [BAHP-082]STRAWBERRY PUSSY HINATA RINA

  • hyuga rina censoredcreampieblowjobBAHPbaltandaibutsu yoshidahoppinBAHP-082BAHP082bahp00082
    • 2021-06-17
    61 min

    336KNB-159 A Bright Erotic Wife Who Really Wanted To Have Sex While Saying For Money! Duero sex where a cheerful wife with zero sense of immorality turns into a woman’s expression with a stick of another person! !! !! !! I will take a gonzo with

  • amateur censoredmarried womanamateurknbknb-159knb159336knb-159
    • 2021-06-29
    60 min

    498DDH-022 Sperm Bukkake Massage On The Whole Body By Saying A Strong Big Tits Beautiful Girl J ●! The sensitive body, which is struck by two virtuous manipulative teachers, cannot resist pleasure!

  • amateur censoredcreampiebig titsddhddh-022ddh022498ddh-022
    • 2021-07-01
    126 min

    [GAS-486]Unveiling The Face Of A Popular Chubby L-cup Prostitute Princess Misa Sakurai

  • misa sakurai censoredbig titssingle workGAScinema unit gasa tgasGAS-486GAS48671gas00486
    • 2021-07-02
    61 min

    230OREC-811 Ran

  • amateur censoredcreampieamateurorecorec-811orec811230orec-811
    • 2021-07-02
    108 min

    [ADN-330]Naughty Teacher Returns To His Alma Mater To Creampie Fuck His Former S*****t For Two Weeks Straight. Hikari Ninomiya

  • hikari ninomiya censoredcreampiesingle workADNattackerssadao sadaokaotona no dramaADN-330ADN330adn00330
    • 2021-07-03
    116 min

    [CMF-062]The Chrysanthemum Gate: A College Girl Who Turns Into A Masochistic Piece Of Livestock: Getting Fucked BY Beasts Over And Over Again - Chisato Mori

  • chisato mori censoredsingle workCMFcinemagicdirty kudoninhuCMF-062CMF062cmf00062
    • 2021-07-04
    39 min

    016DHT-0275 Former Taxi Female Driver ~ Confession True Story Drama ~ Toko Saeki

  • amateur censoredcreampieamateurdhtdht-0275dht0275016dht-0275
    • 2021-07-09
    59 min

    FC2PPV 1913438 [Limited number of 2980 ㊙️ Possibility of suspension of publication] 18-year-old girl’s bar work ❤️ Panty soaked daughter ❤️ Super rare complete appearance ❤️ Natural bushy pubic hair ❤️ Authentic vaginal cum shot with more than d

  • amateur uncensoredfc2
    • 2021-07-14
    54 min

    494SIKA-097 A Natural Makeup Beautiful Girl Who Wants To See A Naughty Appearance 3P

  • amateur censoredschoolgirlamateursikasika-097sika097494sika-097
    • 2021-07-15
    119 min

    [TIKB-115](Sex Log) I Let This Gal Have A Sip And She Turned Into A Slut So Huge I Had To Film A POV Video As I Fucked Her

  • censoredcreampiebig titsTIKBtikitiki.comerTIKB-115TIKB115tikb00115
    • 2021-07-19
    44 min

    FC2PPV 1926346 [No] SSS-Class Super Beautiful Female College Student! Former Lounge Girl Cute Max Girl! F Cup Transcendence Style! 【Selfie】

  • amateur uncensoredfc2
    • 2021-07-29
    55 min

    FC2PPV 1946160 ☆ First Shot ☆ Complete Appearance ☆ Slender Beautiful Girl With Long Black Hair 20 Years Old ♥ Overflowing Sex Appeal And Immediate Wetness Oma ○ I Was Excited About This And Released A Lot ♪ [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-07-30
    148 min

    [JUL-676]I Met My Teacher Again As A Callgirl -Ai Mukai

  • ai mukai censoredmature womansingle workJULmadonnakitorune kawaguchiJUL-676JUL676jul00676
    • 2021-08-12
    58 min

    FCP-034 [Delivery Only] Instead Of Angry Waves, Double Facial Cumshots! !! The Limit To Squeeze Until Empty!

  • amateur censoredamateurslutfcpfcp-034fcp034fcp-034
    • 2021-08-17
    26 min

    FC2PPV 2036103 [Completely New Work] High ◯ Dropout ★ Polite 18-Year-Old Gal With A Broken Rubber And Vaginal Cum Shot Play [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-08-28
    240 min

    [JKSR-507]We"ll Film POV Videos Of Local Amateur Housewives 22 Loose Wives From The Kansai Region 4 Hours

  • censoredcreampiemarried womanJKSRbig mocalobockeypink junkieJKSR-507JKSR50757jksr00507
    • 2021-09-02
    76 min

    FC2PPV 2125468 980 Yen! I Want You To Do This Kind Of Work ♪ Marunouchi Ol Takes A Half Break And Has Sex In A Suit! Even If The Suit Gets Wet Due To Squirting, There Are Also 3 Vaginal Cum Shots & Semen Bukkake On The Suit From The Ass Job ♪ Iroh

  • amateur uncensoredfc2
    • 2021-09-09
    113 min

    [SPRD-1460]Virgin Creampie. My First Time Was Creampie With My C***dhood Friend"s Mom. Kaori Takamatsu

  • kaori takamatsu censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1460SPRD146018sprd01460
    • 2021-09-18
    61 min

    300NTK-635 [Echiechi Bomb Slender God Body Beauty Jd On The Verge Of Libido Explosion Echiechi Swimsuit Shooting! !! ] Kanekoma! ？？ Nonnon ♪ Yara Nakoma ♪ Swimsuit Shooting With A Horny Beautiful Girl Who Wants To Radiate Sexual Desire … There I

  • jdsex censoredcreampieamateurntkntk-635ntk635300ntk-635
    • 2021-09-23
    122 min

    [JURA-042]The Dear Wife, First Time In Her 50s, Again. Reiko Seo

  • reiko seo censoredcreampiemarried womanJURAcenter villagesouthern earthjurakuJURA-042JURA042h-086jura00042
    • 2021-09-30
    93 min

    355OPCYN-187 Amu (Amu Ohara)

  • amateur censoredbig titssquirtingopcynopcyn-187opcyn187355opcyn-187
    • 2021-10-16
    12 min

    FC2PPV 2350291 A Two-Day, One-Night Trip To Kansai With Erika! Erika-Chan Is Naughty Even During A Date!

  • amateur uncensoredfc2
    • 2021-10-23
    129 min

    [BHG-041]Colossal Tits Masked Hottie Succumbs To Sluttiness! Haruka

  • censoredcreampiebig titsBHGgeinko pore shongain corporationBHG-041BHG041bhg00041
    • 2021-10-29
    160 min

    [WAAA-117]Sorry To Keep You! Release of Black World Fuck Megaton Climax of Incontinence and Creampies in Unmatched Big Dick Large Marathon Orgy Kana Yume

  • kana yui censoredcreampiesquirtingWAAAones factorywanzWAAA-117WAAA117waaa00117
    • 2021-11-11
    190 min

    [ABW-166]本番オーケー！？噂の裏ピンサロ 19 AV界随一の美爆乳Hカップを味わい尽くせ！ 渚このみ【MGSだけのおまけ映像付き 10分】

  • amateur censoredbig titsamateurabwabw-166abw166abw-166
    • 2021-12-03
    90 min

    467SHINKI-068 “Extreme” [Train Molester] [Home Voyeur] [Sleep Fuck] Dress Girl Pure White P (Aoi Naruse)

  • amateur censoredcreampieamateurshinkishinki-068shinki068467shinki-068
    • 2021-12-04
    64 min

    SIRO-4716 [First Shot] [White Skin Slender] [Upper Eye-Catching Service] An Active JD Who Attends The Faculty Of Law Has Appeared. A Young Man Who Likes Uncle Makes A Cute Face Caress And Sucks A Penis With A Slender Body .. AV Application On The Net

  • amateur censoredamateursirosiro-4716siro4716siro-4716
    • 2021-12-17
    118 min

    [MEYD-726]I Went To A Rubber Mat Health Club That Didn"t Allow Fucking, And Out Came The Naughty And Haughty Beautiful Married Woman From Next Door. Now That I Knew Her Secret, I Could Demand All The Fucking And Creampie Sex I Ever Wanted! And I

  • riho fujimori censoredcreampiesingle workMEYDtameike gorodai omuraMEYD-726MEYD726meyd00726



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored