room




FC2HZGDSSISMIDVMIDEWAAACAWDNACRSPRDMIAAKSBJAPODVENUNATRAMBINACXNNPJDASDWANZHUNTBSHKD

2020-12-04
71 min

[ETQR-167](Daydream POV) Quickie To Knock Her Up - Loving Sex With My Horny Stepsister Yui Nagase

  • yui nagase censoredcreampieuniformETQRerotic timeETQR-167ETQR167h-1186etqr00167
    • 2020-12-06
    66 min

    300NTK-480 Blow up the chastity idea of a beautiful G cup with an aphrodisiac! !! Complete reason collapse with trembling G milk piston SEX from swaying love! !! Succeeded in becoming a spear man who replaces a big rare cheating stick! !! Those who r

  • amateur censoredcreampiebig titsntkntk-480ntk480300ntk-480
    • 2020-12-12
    63 min

    H0930 ki201212 Gold Pack 20years old

  • amateur uncensoredh0930
    • 2020-12-17
    120 min

    [PPPD-891]My Girlfriend's Stepsister Seduced My Creampie With Her Big Tits Rika Aimi

  • rumi tadami censoredcreampiebig titsPPPDoppaiPPPD-891PPPD891pppd00891
    • 2020-12-26
    148 min

    [WAAA-021]Fainting In Agony: Cunnilingus MANIAX - Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingWAAAwanz factorywanzWAAA-021WAAA021waaa00021
    • 2020-12-27
    56 min

    [oretd-825]Tsumugi

  • amateur censoredcreampieuniformoretdoretd-825oretd825oretd-825
    • 2021-01-06
    52 min

    FC2PPV 1633768 [If you like a beautiful mature woman with a plump naked body, please come and see the most vulgar rich SEX w in the past] I got a forgiveness with a rich SEX as a seeding gift because I got caught NTR on the daughter of a former Yan s

  • amateur uncensoredfc2
    • 2021-01-08
    143 min

    [ABW-044]Endless Sex Act.13 They Keep On Cumming And Going For 179 Fucks In A Cum Crazy Party Large Orgies Past All Limits A 47-Way Uncut, Continuous, 132-Minute Fuck Fest!! Amiri Saito

  • amiri saito censoredcosplaysingle workABWprestigemanhattan kimuraabsolutely wonderfulABW-044ABW044118abw00044
    • 2021-01-09
    118 min

    [IPX-596]Sexy Private Tutor Miss Karen's Kissing Lectures - Individual Lesson Karen Kaede

  • karen kaede censoredblowjobsingle workIPXidea pocketdishIPX-596IPX596ipx00596
    • 2021-01-12
    91 min

    1Pondo 011221_001 The Best 10 Of 2020 Hasumi Yoshioka

  • amateur uncensored1pondo
    • 2021-01-14
    63 min

    336KNB-137 A sad new wife who is sexless even though she is newly married appears on AV! Excellent sensitivity! It blooms disorderly so as to radiate sexual desire that can not be satisfied by my husband! !! I will take a gonzo with this married woma

  • amateur censoredmarried womansquirtingknbknb-137knb137336knb-137
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    118 min

    [SSNI-968]I Always Hated My Girlfriend's Little Sister Because She Always Treated Me Without Any Respect, But We Were Stuck In The Same Room At A Hot Spring Resort Inn, So We Fucked Each Other So Hard I Thought I Was Going To Get Sick Mako Iga

  • iga mako censoredsingle workdramaSSNIs1 no 1 styletiger kosakaiSSNI-968SSNI968ssni00968
    • 2021-01-23
    150 min

    [HND-936]Fresh Face: The No. 1Man-Eater In Asia! This Half-Japanese 6' Knock-Out Babe Makes Her Creampie Debut! By Day She's A High-Powered Career Woman Working For A Foreign Investment Group, But By Night She's A Cock-Loving Wild Kinky S

  • maryjun kinoshita censoredcreampiesingle workHNDhon nakamichiru arashiyamaHND-936HND936hnd00936
    • 2021-01-29
    39 min

    359TYVM-125 Shaved beauty body wife Gachiiki squirting cum cum shot sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-125tyvm125359tyvm-125
    • 2021-02-01
    124 min

    [GOJU-177]"I May Be In My Fifties, But I Still Want To Keep On Fucking." She Wants To Release Her Wealth Of Sexual Knowledge, And So Now, This Beautiful Mature Woman Has Mustered Up Her Courage And Decided To Star In This Adult Video Megumi-s

  • censoredamateurmature womanGOJUfifty somethingGOJU-177GOJU177h-1165goju00177
    • 2021-02-12
    183 min

    [IPX-620]The Nasty Cowgirl Of An Older Sister Wearing Pantyhose - Minami Aizawa

  • minami aizawa censoredslutsingle workIPXidea pocketinaballdishIPX-620IPX620ipx00620
    • 2021-02-16
    243 min

    [MXSPS-661]REQUEST: Ultimate Beautiful Woman Yui Hatano

  • yui hatano censoredbeautiful girlsingle workMXSPSmaxingMXSPS-661MXSPS661h-068mxsps00661
    • 2021-02-19
    200 min

    [FCH-073](Online Only) You Won't Stop Cumming! Beautiful Girls Give Incredible Handjobs! 10 Gorgeous Babes Jerk Off Cocks For 200 Minutes!

  • horikita wa kira ri censoredbeautiful girlslutFCHprestigefetish partyFCH-073FCH073118fch00073
    • 2021-02-26
    52 min

    [ETQR-202](Daydream POV) Creampie Sex With A Beautiful Girl In A Sailor Uniform Shizuku 04

  • censoredcreampieuniformETQRerotic timeETQR-202ETQR202h-1186etqr00202
    • 2021-02-27
    191 min

    [HONB-209]Quickie With A Beautiful Gal With Big Tits BEST

  • censoredbig titsamateurHONBmercuryfirstHONB-209HONB209h-1133honb00209
    • 2021-03-02
    70 min

    [IMPNO-031]A Nudist Cums To Tokyo Minori Tennen

  • natural minori censoredanalsingle workIMPNOimpactIMPNO-031IMPNO031h-1154impno00031
    • 2021-03-07
    64 min

    490FANE-33 Hana 2

  • amateur censoredbig titsamateurfanefane-33fane33490fane-33
    • 2021-04-24
    66 min

    FC2PPV 1784366 [First shot from a rural area] An active underground idol. Her first mass vaginal cum shot to a beautiful girl who likes 18-year-old K-POP. Each other’s first entanglement with Virgin-kun. I couldn’t stand the tight pussy and

  • amateur uncensoredfc2
    • 2021-05-02
    178 min

    [SORA-311]Sex Camp Party Loving Slut Gets Crazy In The Great Outdoors! Mitsuki Aya

  • aya mitsuki censoredsingle workSORAyama to sorahimu lockSORA-311SORA311sora00311
    • 2021-05-04
    139 min

    [KUSE-014]Usually, She's Very Shy ... But This Chinese Girl Is Excessively Horny When It Cums To Sex! When I Opened Up My Heart To Her, She Came Begging For Raw Sex So Hard I Thought She Could Have K**led Me, So I Lifted My Creampie Ban!!! Get Re

  • mie chen censoredcreampiesingle workKUSEsod createkurenai katothis actress style is amazingKUSE-014KUSE0141kuse00014
    • 2021-05-14
    48 min

    285ENDX-344 Big Tits, Fair-skinned and Good Head! What’s more, I love SEX and I’m not satisfied with it even though I’ve been doing it many times!

  • amateur censoredcreampiebig titsendxendx-344endx344285endx-344
    • 2021-05-21
    150 min

    [JUL-575]Never Ending Raw Sex G*******g Marina Shiraishi

  • rena shiraishi censoredcreampiebig titsJULmadonnamamezawa mametaroJUL-575JUL575jul00575
    • 2021-05-22
    125 min

    [APAK-193]S********l Hot Spring Breeding "Breaking In A S*****t With Orgasms On An Overnight Trip..." Hana Himesaki

  • himesaki hana censoredcreampiebig titsAPAKaurora project annexrkAPAK-193APAK193apak00193
    • 2021-06-02
    78 min

    435MFC-111 [Legal Lori Beautiful Girl] Must-see for all Lori ○ N! !! An overwhelming beautiful girl with a very thin waist appears in a short stature! Serve saffle erotically with a minimum body ♪ It feels so good that the climax does not stop! While

  • amateur censoredcreampieamateurmfcmfc-111mfc111435mfc-111
    • 2021-06-10
    189 min

    [PIYO-118]"I Want My Step Dad's Baby!" The Love Between A Small Step Daughter And Her Step Father Leads To Raw Sex...

  • censoredcreampiePIYOhyokopiero daPIYO-118PIYO1181piyo00118
    • 2021-06-12
    121 min

    [AVSA-168]SUPER FISHEYE FETISHISM Intense Exciting Sex Scene Fleshy Pheromone-Filled Body In Sexy Cosplay Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workAVSAavs collector sbuddha davscollector sAVSA-168AVSA168avsa00168
    • 2021-06-16
    247 min

    [DVDMS-672]A Normal Boys And Girls Focus Group Adult Video These Male And Female Colleagues Are Locked In A Room And They Won't Be Let Out Until They Can Produce 20ml Of Semen! In Order To Get Their Male Colleagues To Cum, These Female Employees

  • censoredcreampiebig titsDVDMSdeep ssuttorune iwanagaDVDMS-672DVDMS672dvdms00672
    • 2021-07-11
    35 min

    FC2PPV 1917369 Exfoliation [Individual] Call a woman who escaped and make vaginal cum shot for 3 consecutive times. Ejaculation in the mouth to a light woman who leaked information lightly, conceived with another stick for 2 consecutive days

  • amateur uncensoredfc2
    • 2021-07-24
    240 min

    [JKSR-503]Cute And Distracting Ladies Under 153cm! Petite Ladies You Just Want To Fuck-28 people, 4 hours

  • censoredmarried womanamateurJKSRbig mocalobockeypink junkieJKSR-503JKSR50357jksr00503
    • 2021-07-30
    159 min

    [BBAN-337]Rough Lesbian Plan - Confinement In A Small Room, Experiment On Two Barely Legal Girls -

  • mizuki yayoi mao watanabe censoredschoolgirllesbianBBANbibianBBAN-337BBAN337bban00337
    • 2021-07-30
    119 min

    [ADN-334]I Can"t Believe The Underwear Maker Where My Wife Works Made Her Into A Lingerie Model... Tokyo Maeda

  • maeda momoko censoredbig titssingle workADNattackerskitorune kawaguchiotona no dramaADN-334ADN334adn00334
    • 2021-08-03
    135 min

    496SKIV-015 Nazuna-Chan (21)

  • amateur censoredcreampiesquirtingskivskiv-015skiv015496skiv-015
    • 2021-08-07
    187 min

    [BANS-004]Nihao Saiko 4

  • miyazaki rin eimi kurusu censoredcreampieblowjobBANSniihao saikou mousouzokuBANS-004BANS004bans00004
    • 2021-08-20
    119 min

    [DASD-905]The Summer When I Connected Deeply With My Uncle, Starring Alice Nanase

  • alice nanase censoredcreampiebeautiful girlDASDdasmishima rokusaburoDASD-905DASD905dasd00905
    • 2021-09-15
    83 min

    259LUXU-1484 Luxury TV 1457 Introducing A Beautiful Engineer Who Has Sexual Relations With Multiple Men! It Is A Must-See For The Appearance Of Ascending To Heaven Many Times With An Obscene Smile On A Fierce Piston!

  • amateur censoredbig titsamateurluxuluxu-1484luxu1484259luxu-1484
    • 2021-09-18
    66 min

    H0930 ki210919 Mirai Momoi 27years Old

  • amateur uncensoredh0930
    • 2021-10-01
    88 min

    [NNPJ-473]Needing To Embrace A Top Tier Girl. Taking A Girl From Minato With H-cup Tits Along On A Resort Pool Date That"s Too Hot To Handle. Sex-crazed Guy Enjoys Giving 4 Creampie Cum Loads.

  • censoredcreampiebig titsNNPJnampa japanNNPJ-473NNPJ473nnpj00473
    • 2021-10-02
    138 min

    [SOAV-081]A Married Woman"s Fickle Heart Rika Tsubaki

  • tsubaki rika censoredbig titssingle workSOAVhitodzumaengokai emanuelkiiroi hyouSOAV-081SOAV081soav00081
    • 2021-10-07
    122 min

    [DLDSS-034]If It"s What My Husband Wants ... A Perverted Husband And His Obedient Wife Go On An NTS Hot Spring Resort Vacation Tina Nanami

  • nanami tina censoredsingle workDLDSSdahliaflagmanDLDSS-034DLDSS0341dldss00034
    • 2021-10-16
    140 min

    [DDHH-032]Confinement, Peeing In Her Panties In The Classroom, Mio Mashiro

  • mio mashiro censoredschoolgirldeepthroatDDHHdogmahidekiDDHH-032DDHH032ddhh00032
    • 2021-10-18
    82 min

    259LUXU-1454 Luxury TV 1471 A Pianist With An Attractive Plump Glamorous Body With An Adult Sex Appeal Appears In AV In Search Of A New World! The Body That Has Begun To Ripen Sensually Is Outstandingly Sensitive! The Pant Voice That Echoes Annoyingl

  • amateur censoredbig titsamateurluxuluxu-1454luxu1454259luxu-1454
    • 2021-10-22
    93 min

    [VEC-501]Wife Betrayed By Mom Friend And Creampied By Scum, Minami Nagata

  • minami nagata censoredcreampiemature womanVECvenustamatsuka bingomegami venusVEC-501VEC501vec00501
    • 2021-10-26
    61 min

    HEYZO 2638 FFM Threesome – That’s Man’s Dream! Vol.7 – Miyu Morita – Honoka Orihara

  • miyu morita honoka orihara uncensoredcreampieblowjobheyzo
    • 2021-11-06
    120 min

    [NASH-599]Working Mature Lesbian. Sweet Trap That Would Cause Any Woman To Become a Lesbian.

  • censoredlesbianmature womanNASHpinknadeshikoNASH-599NASH599nash00599
    • 2021-11-12
    121 min

    [PRED-359]I"ll Overwrite The Scent On Her Body, Hooked On Deep Kisses, Blowjobs, and Mind-Blowing Weekend Sex With Her Best Friend Tsukino Luna

  • tsukino luna censoredcreampieblowjobPREDpremiumtakarase hironorielegancePRED-359PRED359pred00359
    • 2021-11-19
    61 min

    FC2PPV 2447319 Active J ◯ Pocha × 2 Kawa Who Is Nervous ❤ Massive Love Juice & Squirting From Pure Innocent Minimum Vagina ❤ Armpit Job On Marshmallow Body, Transformation Play Of Oral Ejaculation ❤

  • amateur uncensoredfc2
    • 2021-11-19
    87 min

    393OTIM-095 [Delusional Subjectivity] Sexual Intercourse With A Beautiful Girl With Big Tits Riho Takahashi

  • amateur censoredcreampiebig titsotimotim-095otim095393otim-095
    • 2021-12-03
    158 min

    [CAWD-317]This Beautiful Girl Is Super Shy, But The Truth Is That She Was Always Infatuated With The Glamorous World Of Adult Videos Futaba Kurimiya In Her Adult Video Debut

  • kurimiya futaba censoredbeautiful girlsingle workCAWDkawaiitorendei yamaguchiCAWD-317CAWD317cawd00317
    • 2021-12-18
    144 min

    [DPMI-065]Drop Dead Gorgeous Ballerina, Swan Shiratori

  • swan censoredsingle workDPMImiludopamixDPMI-065DPMI065dpmi00065
    • 2022-01-01
    160 min

    [LULU-115]Wife Looking To Start Fresh On Her Second Marriage Has A Step-daughter With A Big Ass That Is Just Too Good, Now She"s My Favorite Step-daughter Who Sucks Me Down Her Throat And Swallows My Cum Loads Every Day. Yui Tenma

  • yui tenma censoredcreampieschoolgirlLULUlunaticsluminaxLULU-115LULU115lulu00115



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored