rui




FC2JULVENXNGODDASDFSDSSMEYDPPPDMIDEMVSDSANLULUGVHRBDGMEMBBANATIDPREDWANZMILKHND

2020-09-26
171 min

[WANZ-984]If You Can Resist Ichika Matsumoto's Amazing Technique, You'll Receive Raw Creampie Sex!

  • ichika matsumoto censoredcreampieblowjobWANZwanz factorywanzWANZ-984WANZ984wanz00984
    • 2020-09-27
    54 min

    230OREX-186 Chiharu

  • amateur censoredbig titsamateurorexorex-186orex186230orex-186
    • 2020-10-08
    53 min

    [h0930-ki201008]椎名 真紀 34歳

  • amateur uncensoredh0930
    • 2020-10-22
    69 min

    [SIROR-033]The Work Of A Mature Woman For Rent - The Secret Side Of A Wife That Her Husband Will Never See - FILE NO.33

  • censoredcreampiebig titsSIRORdispatched.comSIROR-033SIROR033h-1492siror00033
    • 2020-10-23
    61 min

    [jrai-002]あおい

  • amateur censoredamateurjraijrai-002jrai002jrai-002
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-25
    52 min

    330PER-332 Mitsuha 2

  • amateur censoredamateurcosplayperper-332per332330per-332
    • 2020-11-01
    297 min

    [DMOW-213]Footjobs For Masochistic Men Complete Works: 5 Hours

  • mizuno chaoyang blue censoredslutDMOWoffice k smowDMOW-213DMOW21336dmow00213
    • 2020-11-06
    49 min

    [gerk-324]ゆうりさん

  • amateur censoredbig titsamateurgerkgerk-324gerk324gerk-324
    • 2020-12-03
    148 min

    [AKDL-069](An Amateur Interview) She's Performing In This Adult Video Without Telling Her Parents She Has A Cute Name For Her Pussy This Nice Girl Is Beautiful But Bashfully Cumming For The First Time Rui 20 Years Old Occupation: Trade School S**

  • censoredamateurbeautiful girlAKDLaquinoriaquinoriaknrAKDL-069AKDL0691akdl00069
    • 2020-12-05
    171 min

    [URE-061]The Ultimate Hyponotic Seduction! Creator: Riku Aijo From The "Hypnotic Instructions" Series Comes Hypnotic Instructions 4: Instructions For Getting Girls Pregnant Maki Hojo And Ruka Inaba

  • hojo asahi inaba censoredschoolgirlmature womanUREmadonnakitorune kawaguchiure.comiURE-061URE061ure00061
    • 2020-12-10
    104 min

    [SPRD-1352]Creampie Sex With Your Stepmom - His First-Ever Creampie Hikari Azuma

  • hikari higashi censoredmarried womanmature womanSPRDtakara videoninety nine rotaaleddinSPRD-1352SPRD135218sprd01352
    • 2020-12-10
    240 min

    [HEZ-231]Wanna See How Ordinary Downtown MILFs Let Loose？ They Look Mature, But They Get Wild Like You'd Never Imagine In The Bedroom At The Chance For Orgasms Like They Used To - Passionate, Ecstatic Creampie Sex 3 16 Girls

  • censoredcreampiebig titsHEZhot entertainmentaunt chHEZ-231HEZ23159hez00231
    • 2020-12-24
    75 min

    326EVA-150 Saffle is growing due to devilish desire ww In the past, 3P experience ants in Carsek & mountains during BBQ! !! Duero GAL who picked up the sea and [mouth x 1] [creampie x 3] [sperm 4 barrage] fierce pacoli! !! Rough big butt trained

  • amateur censoredcreampieamateurevaeva-150eva150326eva-150
    • 2020-12-27
    140 min

    [EVIS-331]Sensitive Acme, Climaxing Lesbian Nipples

  • jinno hina toua kotone censoredlesbianEVISebisusan mousouzokumad dogEVIS-331EVIS331evis00331
    • 2021-01-01
    120 min

    [NACR-382]Lady Editor Becomes Older Author's Personal Sex Pet Sumire Mizukawa

  • mizukawa violet censoredcreampieblowjobNACRplanet pluscherryshichidomeNACR-382NACR382h-237nacr00382
    • 2021-01-05
    207 min

    [STARS-316]Compliant Hot Springs Trip - Hikari Aozora

  • hikari aozora censoredsingle workSTARSsod createsuisei akaisod starSTARS-316STARS3161stars00316
    • 2021-01-12
    61 min

    Caribbeancom 011221-001 Give Yourself a Boner! Beautiful Lady Molester Squeeze Out Your Sperm! Yui Shinjo

  • yui shinjo uncensoredcreampiehandjobcaribbeancom
    • 2021-01-15
    61 min

    FC2PPV 1638282 [Uniform Gonzo] Rui ☆ Special price ♪ Black hair twinte × uniform is a combination of royal roads ☆ Of course I will not take it off naked until the end (basic of cosplay etch) ★ Geki Saddle demon thrust [Review special

  • amateur uncensoredfc2
    • 2021-01-15
    245 min

    [NPS-407]Real Pickup! Prim, Proper, Pretty Girl Has Her First Ever Orgasm And Just Can't Stop - Humping Her Hips For Infinite Orgasms! 129 Climaxes! 14 Loads!

  • censoredcreampieamateurNPSpeterskensuke kikuchinampazuNPS-407NPS407h-021nps00407
    • 2021-01-16
    182 min

    [DVDMS-621]I Want To Fuck My Big Tits Big Stepsister... This Little Stepbrother Confessed His Warped Desires For His Big Stepsister And After Much Conflict, She Accepted Mei Satsuki

  • satsuki mei censoredcreampiebig titsDVDMSdeep sgreenhouse effectDVDMS-621DVDMS621dvdms00621
    • 2021-01-19
    52 min

    S-Cute pok_006 Gonzo H that makes a half beautiful woman seriously squid / Eve

  • amateur censoredamateurpokpok-006pok006pok-006
    • 2021-01-29
    56 min

    326HGP-016 [Back customs] A storm of unstoppable cum! !! Raw insertion ⇒ Immediately super sensitive Ma ● Ko! G-spot aiming close contact slot ~ Gacking with a piston! Creampie in a single mother who is de M who gets wet with restraint play! !!

  • amateur censoredcreampieamateurhgphgp-016hgp016326hgp-016
    • 2021-02-06
    164 min

    [PRED-285]What If You Were Alone With Aika Yamagishi？... Sweaty, Passionate, Secret Situations With A Born Slut

  • aika yamagishi censoredcreampieblowjobPREDpremiummametaro mamezawaelegancePRED-285PRED285pred00285
    • 2021-02-09
    79 min

    498DDH-002 In a shared room with a subordinate of a model body who seems to be highly conscious and a hotel on a business trip … “Yadayada” While panting, she shakes her hips at the woman on top posture and trembles without being able

  • amateur censoredamateurddhddh-002ddh002498ddh-002
    • 2021-02-17
    301 min

    [HOISW-002]Sweet! Champion 2 A Beautiful Girl Fuck Buddy Cosplayer! / Cosplay / Nerd Members / POV / Private Videos / Amateur / Big Tits / Cum Swallowing

  • censoredbig titsamateurHOISWamateur hoi hoi sweet mousouzokufresh gordonHOISW-002HOISW002hoisw00002
    • 2021-02-21
    158 min

    [HND-954]A Married Woman's Salive, Love Juices And Semen All Get Mixed Up As They Come Out Of Her Pussy - Creampie Sex

  • censoredcreampieblowjobHNDhon nakacontour styleHND-954HND954hnd00954
    • 2021-03-02
    69 min

    [IMPNO-032]"Does Sex Feel Good？" Imoka Onono

  • i m afraid censoredanalsingle workIMPNOimpactnon label impactIMPNO-032IMPNO032h-1154impno00032
    • 2021-03-25
    135 min

    1Pondo 032521_001 Ryu Enami : Ryu Enami Special Edition

  • amateur uncensored1pondo
    • 2021-04-20
    99 min

    [YOZ-385]Straight From Tokyo! Widowed Mature Woman Callgirl's Raw Fucking Negotiations! 2

  • censoredblowjobmature womanYOZstar paradiseyaozokuYOZ-385YOZ385h-254yoz00385
    • 2021-04-23
    93 min

    380SQB-098 Shizuku

  • amateur censoredsquirtingamateursqbsqb-098sqb098380sqb-098
    • 2021-05-07
    161 min

    [MIST-335]Fucking While Ovulating! A Brothel Where You Can Get Girls Pregnant 28 June Lovejoy

  • june lovejoy censoredcreampiecosplayMISTmr michirusaitaMIST-335MIST3351mist00335
    • 2021-05-28
    153 min

    [MIFD-159]Amateur 20 Year Old I'm Having A Hard Time Being True To Myself Porn Debut Yuika Aoi

  • yuka aoi censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-159MIFD159mifd00159
    • 2021-06-02
    120 min

    [OVG-172]When She Rubbed My Cock With Her Pussy With Some Oily Pussy Grinding Pleasure, It Felt So Good That I Got A Rock Hard Erection! And I Unexpectedly Slipped My Jimmy In Without A Rubber On!! Real Sex Wasn't Allowed, But This Delivery Healt

  • prayer kisumi miyuki nanako censoredcreampiebig titsOVGglory questOVG-172OVG17213ovg00172
    • 2021-06-11
    120 min

    [EBOD-830]24 Hours Cooped Up With A Hot Young Shut-In Nerd Girl With Huge Tits For Aphrodisiac-Addled Creampie Sex Nemu Kisaki

  • kisaki nemu censoredbig titssquirtingEBODe bodymichiru arashiyamaEBOD-830EBOD830ebod00830
    • 2021-06-19
    178 min

    [CAWD-236]I Love Fat Guys! Suffering Is Pleasure ... A Super Maso Positive Girl! She Loves Sex So Much, Because It Feels So Good, She Can't Stop Smiling In Her Debut Airi Takada

  • airi takada censoredbig titssingle workCAWDkawaiikyoseiCAWD-236CAWD236cawd00236
    • 2021-07-08
    193 min

    [SUN-020]Orgy D***king Cum Surrounded By Dicks, I Just Want to D***k It. I Want To Fuck. Exposure Is Also OK. Convenient

  • mori nanako censoredbig titssingle workSUNsuntanaka baconSUN-020SUN02013sun00020
    • 2021-07-13
    58 min

    499NDH-025 [Kinshicho’s reflex signboard girl. ] I thought that it was a calm and calm girl with a cute voice, but I picked up a huge breasts de M erotic signboard girl who likes to have sex intensely [Rumor! Tokyo signboard girl. 4th person]

  • amateur censoredbig titsamateurndhndh-025ndh025499ndh-025
    • 2021-07-21
    87 min

    435MFC-125 [Sexual Beast Metamorphosis Bunny] If You Don’T H, You’Ll Die! ？？ Beautiful Busty Body With Strong Libido Pyon-Chan Is Here! Jumping At The Woman On Top Posture While Being Alive ♪ 2nd Round Of Vaginal Cum Shot With Raw Saddle So

  • amateur censoredcreampiebig titsmfcmfc-125mfc125435mfc-125
    • 2021-07-29
    243 min

    [CVDX-457]You Perverted Large Circles That Are Signs, Be In Full Bloom!! Ladies With Huge Areolas: 30 Women, 4 Hours

  • censoredcreampiemarried womanCVDXcenter villageCVDX-457CVDX457h-086cvdx00457
    • 2021-08-03
    66 min

    200GANA-2477 Seriously Nampa, First Shot. 1671 I Picked Up A Stuffed Animal With A Ufo Catcher And Investigated The Sex Of Imadoki Girls Who Came With Hoi Hoi And The Hotel! "I’M Not Confident Because I’M Small …" Kyun Died As

  • amateur censoredamateurganagana-2477gana2477200gana-2477
    • 2021-08-06
    185 min

    FC2PPV 1960983 [No Amateur Individual Shooting] 100th Work Arrival Commemorative Exposure Work! Large Release Of All The Cultivated Exposure! Perverted Superb Body Naked Wife’S Outdoor Continuous Naked Exposure! The Tag Comes Off And It Becomes

  • amateur uncensoredfc2
    • 2021-08-13
    240 min

    [OOMN-276]This Married Woman Has Excessively Huge Titties And Is Luring You To Temptation ... What A Super Selection Of Titties! Fondle Them, Suck Them, Make Them Jiggle And Wiggle During Alluringly Exquisite Sex 2

  • censoredbig titsmilfOOMNabc delusion groupmom.com abc delusion groupOOMN-276OOMN276oomn00276
    • 2021-08-19
    195 min

    [ABW-134]神乳Gcupを味わい尽くす性感覚醒3本番 神乳界の超新星 天然G乳 神谷凪 【MGSだけのおまけ映像付き 10分】

  • amateur censoredbig titsamateurabwabw-134abw134abw-134
    • 2021-08-26
    119 min

    [DLDSS-024]Celebrity Wife Downfall NTR A Record Of A Former Rich Married Woman Who Started Working At A Convenience Store And Was Fucked By Creepy Store Manager Who Made Her Cum Tina Nanami

  • nanami tina censoredsingle workdramaDLDSSdahliatake dDLDSS-024DLDSS0241dldss00024
    • 2021-09-04
    136 min

    [RMER-006]118 kj Super Thick H Cup Mature Woman Porn Debut Aki Kozaka

  • aki kosaka censoredmature womansingle workRMERmare rare mousouzokushimokita kickmareRMER-006RMER006rmer00006
    • 2021-09-17
    124 min

    [PPPD-963]Cum Loving Slut With Soft Tits Enjoys A Titty Fuck. Total Course Of Sticky Loads For Cum Swallowing. Honoka Tsujii

  • tsujii honoka censoredbig titsslutPPPDoppaiPPPD-963PPPD963pppd00963
    • 2021-10-01
    120 min

    [NACR-467]Betrayed By My Beloved Husband... Atsuko Nakajima

  • atsuko nakajima censoredcreampiesingle workNACRplanet plussakura ninshichi ku ryuuNACR-467NACR467h-237nacr00467
    • 2021-10-09
    40 min

    C0930 ki211010 Keiko Ayata 43years old

  • amateur uncensoredc0930
    • 2021-10-20
    66 min

    SIRO-4671 [First Shot] [Sensitive Constitution That Gets Wet] [M Nature That Is Revealed] A Beautiful Receptionist Who Creates A Fluffy Soft Healing Aura. A Sensitive Body That Seems Pure And Has A Gentle Appearance Wets Her Underwear Thoroughly Just

  • amateur censoredamateursirosiro-4671siro4671siro-4671
    • 2021-10-22
    122 min

    [HMN-068]My Female Boss" Secretive Side That Only I Know About. Soothing And Delicate Dirty Talk With A Blowjob That Makes A Dick Go Crazy With Pleasure. This Hot Date Ends With A Passionate French Kissing Creampie.

  • mina kitano censoredcreampiebig titsHMNhonnakarassha miyoshiHMN-068HMN068hmn00068
    • 2021-11-05
    230 min

    [HUNTB-133]"It"s Amazing When I Get Naked Like This!" 2 - She"s Barely Legal And Younger Than Me, But This School Friend Has An Amazing Sexy Style That Gives Me A Full Hard-on In No time.

  • censoredcreampieblowjobHUNTBhuntervolvo nakanohhh groupHUNTB-133HUNTB133huntb00133
    • 2021-11-20
    241 min

    [SUPA-599]-True Amateur Nakadashi - Amateur X Creampie = Priceless! The Ultimate BEST!

  • censoredcreampiebig titsSUPAskyu shirotok taroSUPA-599SUPA599supa00599
    • 2021-11-30
    60 min

    [113021-001]Bitch Maid Who Will Having Sex Immediately: Good Morning Master, Oh!

  • emiri miura uncensoredcreampiehandjobcaribbeancom
    • 2021-12-04
    120 min

    [AUKG-528]Lesbian Stalker. I Was Targeted By A Little Devil Girl In Uniform. Aoi Mizutani, Tsugumi Misuzawa

  • aoi mizutani tsugumi mizusawa censoreduniformlesbianAUKGu krentoAUKG-528AUKG528aukg00528
    • 2021-12-10
    166 min

    [IPX-785]Deep Drooling Saliva Swapping Kiss And Creampie Sex With Beautiful Girl. Amiri Saito

  • amiri saito censoredcreampieblowjobIPXidea pocketdishIPX-785IPX785ipx00785



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored