school uniform high vision schoolgirl blowjob jav




FC2CHRVBLKGMEMAUKSJUFERBDMVSDLULUVENXNATRIPXAVSAMIDVCAWDATIDSSISMEYDGVHSQTEDTT

2020-11-02
57 min

407KAG-097 A layer beautiful girl who seems to be neat is a throat metamorphosis woman with a strong libido ☆ Reason completely collapses to the sensitivity that is taken and aggression ww

  • amateur censoredamateurcosplaykagkag-097kag097407kag-097
    • 2020-11-28
    56 min

    FC2PPV 1587036 [Personal shooting] ♀283 There is a cake shop clerk ◯ -chan 20 years old 1st time Dangerous day of a slender beautiful girl ◯ Ko is irresponsibly impregnated with a ruthless genuine vaginal cum shot and seeded!

  • amateur uncensoredfc2
    • 2020-12-01
    69 min

    326HGP-010 The erotic goddess descends into the night city! !! A transcendental style beauty who releases pheromones from E milk! Cunnilingus without permission of a defenseless beauty man who fell asleep ⇒ Wake up immediately ♪ A large amount of vag

  • amateur censoredcreampieamateurhgphgp-010hgp010326hgp-010
    • 2020-12-05
    24 min

    FC2PPV 1595947 [Ends today] Dating This time, when I stabbed Paiotsu and Kitsuman who had grown at the hotel, I was in a half-crying state ★ So I made a vaginal cum shot

  • amateur uncensoredfc2
    • 2020-12-07
    41 min

    [ore-733]ミサト 2

  • amateur censoredcreampiebig titsoreore-733ore733ore-733
    • 2020-12-12
    125 min

    [IPX-584]My Classmate Yume Wants To Raise Her Sex Game, And Since I'm Known As The Professor Of Sex, She Decided To Undergo An Ejaculation Experiment With My Cock Until I Came A Deep And Rich Sex Seminar During Some Down Time To Learn About How T

  • yume nishinomiya censoredschoolgirlblowjobIPXidea pocketdragon nishikawadishIPX-584IPX584ipx00584
    • 2020-12-20
    146 min

    [HND-931]I Couldn't Meet With My Lady Boss So She Was Breaking In My Ass Remotely And We Conducted Mutual Masturbation For 30 Straight Days, And After That, We Released Our Pent-Up Lust With Creampie Sex. Yui Hatano

  • yui hatano censoredcreampieslutHNDhon nakajo asagiriHND-931HND931hnd00931
    • 2020-12-20
    154 min

    [CAWD-160]She's Pure And Honest And Full Of Lust! This Beautiful Girl Has Soft And Plump Skin 19 Years Old Nozomi Aota Her Adult Video Debut

  • aoda nozomi censoredcreampiebeautiful girlCAWDkawaiikyoseiCAWD-160CAWD160cawd00160
    • 2020-12-24
    96 min

    [KAAD-050]Our Lovely Mother-In-Law Misono Takahashi

  • takahashi misono censoredcreampiemarried womanKAADcenter villagejiro fukagawahanazono center villageKAAD-050KAAD050h-086kaad00050
    • 2020-12-26
    155 min

    [MIAA-371]Double Temptation Of Two Former Girlfriends: Whispering Dirty Slutty Talk Into Both My Ears, And Making Me Creampie Them! With Ai Mukai And Noa Eikawa

  • ai mukai sakaegawa noa censoredcreampieslutMIAAmoodyzham the mceveryone s porn starMIAA-371MIAA371miaa00371
    • 2020-12-31
    118 min

    [ATID-448]Secret Mid-Day Adultery Training She Can't Reveal To Her Husband: I Spotted A Beautiful Married Woman On The Street One Day, And A Few Days Later... Yui Hatano

  • yui hatano censoredsingle workATIDattackersnagira kenzoin madATID-448ATID448atid00448
    • 2021-01-01
    305 min

    [DKSB-099]"Are You Going To Film Me... From So Close？" Amateur Girls Get Their First Experiences With Dildo Masturbation While Being Filmed In Sparkling And Filthy Angles An Immoral Video Record! 5 Hours!

  • censoredamateurDKSBoffice k sk s bestDKSB-099DKSB09936dksb00099
    • 2021-01-01
    53 min

    FC2PPV 1628358 * Limited time 3980⇒2980pt ★ Super rare amateur ☆ The trained beauty BODY Maiko is coming back! ☆ Beautiful erotic body is bewitched and vaginal cum shot! [Luxury privilege ♥ Wake up private raw vaginal cum shot SEX video gift! ]

  • amateur uncensoredfc2
    • 2021-01-15
    105 min

    483SGK-010 [Unprecedented frenzy climax] [Raw Saddle 2 barrage] [Amazing convulsions] [Big breasts big butt] [G-cup] A pair of late mega gifts! !! Unprecedented! Transcendental agony! Infinite convulsions! Santa Claus is coming down! The butt that sw

  • amateur censoredcreampiebig titssgksgk-010sgk010483sgk-010
    • 2021-01-23
    241 min

    [ITSR-088]"Taking Them Home" A Divine Collection Peeping On A Big Tits Married Woman 12 Ladies/4 Hours vol. 5

  • censoredbig titsITSRbig morkalmaxitadakiITSR-088ITSR08857itsr00088
    • 2021-01-24
    54 min

    299EWDX-342 A wife with a neat face and a big gap under her dress wearing underwear.

  • amateur censoredcreampiebig titsewdxewdx-342ewdx342299ewdx-342
    • 2021-01-28
    54 min

    FC2PPV 1663070 [Outstanding style] I have done 3P for the first time with a beautiful female college student and two old men ♥♥

  • amateur uncensoredfc2
    • 2021-01-30
    125 min

    390JAC-081 [End of the century savior G huge breasts GAL x 5 cum shot facials] Fierce fighting dance TURBO! Rainbow aura continuation rate 89 confirmed! A fierce battle against two strong enemies in the AV world! Cum Inside Musou 3P Geki RUSH Creampi

  • ggal censoredcreampiebig titsjacjac-081jac081390jac-081
    • 2021-02-06
    19 min

    FC2PPV 1675096 [3P Raw Creampie Real NTR] A married woman who tries to make lightly pickled cucumber for tonight’s husband’s side dish

  • amateur uncensoredfc2
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-12
    64 min

    [YMDS-024]Street Corner Snapshot #TokyoMaskGirls (Konoha 23 Years Old Office Worker)

  • censoredamateurYMDSmomotaro video publishinghimrockyoung peachYMDS-024YMDS024ymds00024
    • 2021-03-27
    237 min

    [XVSR-587]Titty Heaven BEST

  • kimishima mio aika censoredcreampieXVSRmax amax ikacalenXVSR-587XVSR587xvsr00587
    • 2021-04-01
    54 min

    [AKDL-098](Tokyo Girls) Debut On Her Way Home From Work! This Brand New Model Glitters Like A Gem At Night! Total Innocence: She's Only Had Three Lays In Her Whole Life, Now Her Pussy Gets Pounded By A Huge Cock! Rookie Model Karen, Age 21

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-098AKDL0981akdl00098
    • 2021-05-02
    115 min

    [PKPD-144]Compensated Dating - Creampie OK! 18 Year Old Petite Hottie Ichika Nagano

  • ichika nagano censoredcreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-144PKPD144pkpd00144
    • 2021-05-19
    120 min

    [GVH-238]Family Fun Mako Oda

  • oda mako censoredcreampiebig titsGVHglory questkabin kizakuraGVH-238GVH23813gvh00238
    • 2021-06-03
    485 min

    [AKDL-116]9 Fucks Involving Barely Legal Babes Who Love Older Men And Will Get Their Slut On While Smiling And Getting Them Erect Even If Their Wives Are Nearby

  • sana moribo yoko kokoro censoredbig titsbeautiful girlAKDLaquinoriaquinoriaknrAKDL-116AKDL1161akdl00116
    • 2021-06-03
    130 min

    [278GZAP-048]スケベな恵体なので心配な僕の巨乳尻妻が法事の席で泥酔し巨根の親戚達からオナホ同然の3P●●されてしまい悔しいのでそのままAV発売お願いします

  • amateur censoredcreampiebig titsgzapgzap-048gzap048278gzap-048
    • 2021-06-20
    154 min

    [CEMD-023]Yui Hatano Goes Picking Up Girls For Lesbian SEX In The Street! Wanna Try Some Girl On Girl...？ vol. 2

  • yui hatano censoredamateurlesbianCEMDceleb no tomoCEMD-023CEMD023cemd00023
    • 2021-07-08
    120 min

    [IENF-150]We Seduced This Currently Active Nurse Who Was Willing To Show Her Face On Camera! This Angel In White Will Cure A Man Suffering From Erectile Dysfunction! When She Got Him Rock Hard Again, She Happily Let Him Have Creampie Sex!

  • tsubaki rika hamazaki mao censoredcreampieuniformIENFie nergytaiga kosakaiienfIENF-150IENF1501ienf00150
    • 2021-07-08
    121 min

    [FSDSS-251]An Aphrodisiac Raises Sexual Desire To The Limit Before The Shoot Begins. Insatiable Lust And Pleasure. Sora Amakawa

  • tenkawa sora censoredbig titsblowjobFSDSSfalenowild sevenfaleno starFSDSS-251FSDSS2511fsdss00251
    • 2021-07-09
    121 min

    [MIAA-465]On a Hot Spring Trip With My Nieces, We Go Into the Men's Bath Together, I was F***ed to Come 10 Times By Barely Legal Chicks Playing Pranks. Ichika Matsumoto Lala Kudo

  • ichika matsumoto lara kudo censoredcreampiebeautiful girlMIAAmoodyzeightminna no kikatanMIAA-465MIAA465miaa00465
    • 2021-07-10
    110 min

    [VEC-484]The Married Woman Next Door who Arouses the Cherry Boy with her Front Hoock Bra and Small Panties Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanVECvenuskaniemegami venusVEC-484VEC484vec00484
    • 2021-07-29
    486 min

    [GOMU-027]Coming of Age in Center Village. First half of 2021, BEST 8 hours (2 discs, 112 titles), all complete scenes - now available!!

  • censoredcreampiemarried womanGOMUcenter villageGOMU-027GOMU027h-086gomu00027
    • 2021-08-03
    136 min

    [SDMM-094]Magic Mirror Bus, College Girls Going To Tokyo Only! Intense Vibrating Climax Chair Switch ON While On Video Call With Boyfriend! She Wins A Prize If She Finishes The Call Without Being Found Out! But... Her Clit Is So Stimulated That Her N

  • amaha noi censoredsquirtingamateurSDMMsod createdainanamirror noSDMM-094SDMM094
    • 2021-08-13
    68 min

    483SGK-037 [Face Deviation Value East ● University Level] [Tsundere Super M] [Neck ● Medeiku] [Too Cute 20-Year-Old Beauty Member] [Real Pink Nipple] Or Cute … Too Cute! Facial Deviation Value! People Who Shouldn’T Come To Such A Shameless

  • amateur censoredamateurbeautiful girlsgksgk-037sgk037483sgk-037
    • 2021-08-27
    122 min

    [EKW-073]No-Choice Rapid-Fire Ejaculations Through Provocative Dirty Talk! The Teasing Female Pervert Who Milks You Of Your Semen, Ayane Sezaki

  • ayane sezaki censoredcreampieblowjobEKWwaap entertainmentk westcobra waapEKW-073EKW0732ekw00073
    • 2021-09-04
    71 min

    200GANA-2548 Seriously Nampa, First Shot. 1684 If You Were Distributing Uchiwa For Free In Shibuya, You Succeeded In Picking Up A Baby-Faced Beautiful Girl JD! The Delicate Body Is Violently Embraced By The Big Cock Actor And Trembles With Pleasure!

  • amateur censoredamateurganagana-2548gana2548200gana-2548
    • 2021-09-08
    59 min

    FC2PPV 2175218 [Missya 〇 Maga Outflow] Cuteness Max (New 18 Years Old) Immediately After The Grand Prix Vote, He And His Summer Vacation Date Leaked Gonzo Vaginal Cum Shot Paipanmanko ♥ Personal Shooting [Handling Caution]

  • amateur uncensoredfc2
    • 2021-09-09
    159 min

    [SW-797]My Classmate First Love With Big Tits And My Female Teacher With A Big Ass Meet At The Class Reunion To Fuck! 10 Years Later She Is a Married Woman With A Curvy Ass And Tits, Now I"m Too Hard And She"s Working My Dick At The Store, Ho

  • censoredbig titsSWswitchyocchanswitch hibinoSW-797SW7971sw00797
    • 2021-09-10
    115 min

    [JUL-706]Lonely In My Fishbowl Life. Iori Nanase

  • iori nanase censoredcreampiebig titsJULmadonnainaballJUL-706JUL706jul00706
    • 2021-09-24
    166 min

    [MISM-213]There"s No One To Teach Me In My Home Town... I Applied Because I Want To Do More... Anus Deepthroat Vagina Masochist Girl Coming To The Capital Three-Hole Luxury Debut Of Aoi-Chan

  • censoredanalcreampieMISMemumusume labinnabarMISM-213MISM213mism00213
    • 2021-09-24
    146 min

    [HMN-045]I Can Get Through Life With This Body! Shut-in With Incredible Narrow Waist Body. First-time Raw Creampie. Yuria Hakaze

  • yuria hafu censoredcreampiebeautiful girlHMNhonnakamamezawa mametarouHMN-045HMN045hmn00045
    • 2021-10-19
    64 min

    016DHT-0331 174cm Former English School Instructor Creampie Debut! Yuno Hirase

  • amateur censoredcreampieamateurdhtdht-0331dht0331016dht-0331
    • 2021-10-22
    119 min

    [DASD-928]Brainwashed Into Thinking It Was The End Of The World, I Let Them Keep Me Locked Up. Kotone Toa

  • toua kotone scooping censoredcreampiebeautiful girlDASDdasinugami ryouDASD-928DASD928dasd00928
    • 2021-11-04
    57 min

    230OREC-924 Chiharu (Chiharu Sakurai)

  • amateur censoredcreampieamateurorecorec-924orec924230orec-924
    • 2021-11-12
    179 min

    [MVSD-487]I"ll Be Your Lover Until Graduation I Don"t Trust Women, But Rino-Sensei"s Healing Boobs Wrap Up My Heart And D*ck, Nasty, Close Slow Sex Yuki Rino

  • yuki rino censoredcreampiebig titsMVSDm s video groupms video groupMVSD-487MVSD487mvsd00487
    • 2021-11-18
    126 min

    [KAAD-059]My Beautiful Mother-in-law, Reiko Seo

  • reiko seo censoredcreampiemarried womanKAADcenter villageshibuyahanazono center villageKAAD-059KAAD059h-086kaad00059
    • 2021-11-30
    66 min

    200GANA-2603 Seriously Nampa, First Shot. 1722 Muchimuchi Raw Foot Gal Found In Shinjuku At Night! Over 100 Experienced People! ？？ Again, When I Grabbed Mutchimuchi’s Ass And Showered It With A Merciless Piston, I Was Panting With A Cute Voice A

  • amateur censoredamateurganagana-2603gana2603200gana-2603
    • 2021-12-11
    70 min

    FC2PPV 2510013 18-Year-Old Fair-Skinned Slender Beautiful Girl, A Female College Student Full Of Cleanliness. She Panting With A Wet Pussy While She Is Elegant And Cums. A State Of Absentmindedness To Her First Mass Facial Cumshot In Her Life.

  • amateur uncensoredfc2
    • 2021-12-28
    99 min

    [NUBI-058](Acts Of Shame In The Bookstore) A College Girl Is Shamed In The Bookstore His Rock Hard Cock Entered Her Dripping Wet Cunt, And She Started Massively Squirting

  • censoredsquirtingblowjobNUBIkarimantannubiaNUBI-058NUBI058h-1112nubi00058
    • 2021-12-28
    69 min

    OREX-328 Rin 3 (Rin Kira)

  • amateur censoredcreampieamateurorexorex-328orex328orex-328
    • 2021-12-30
    128 min

    [AARM-046]When This Famous Adult Video Actress With Tons Of Experience Decided To Start Working At A Men"s Massage Parlor, She Was So Sexy And Her Pheromones So Powerful That The Story Was That She Could Easily Suck The Life Out Of Her Customers

  • kobayakawa reiko akari shinmura censoredmature womanAARMaroma planningshigeo kadowakiaromaAARM-046AARM046aarm00046
    • 2022-01-11
    90 min

    GLP-001 Hi-chan (Karen Asahina)

  • amateur censoredbig titssquirtingglpglp-001glp001glp-001
    • 2022-01-13
    135 min

    [IENF-187]Amateur Picking Up Girls. Finding A Naive S********l In Shinjuku That Gets A 18cm Huge Dick Between Her Thighs, And Then It Just Gets Even More Lewd From There.

  • satoshi kuruki horikita wan censoredcreampieschoolgirlIENFienergyienfIENF-187IENF1871ienf00187
    • 2022-01-14
    120 min

    [PPPD-996]Detestable Boss Fondles Her Sexy Tits During Overtime For The Perfect Workplace Harassment. Female Employee Gets Her Sensitive Colossal Tits Worked Over For Pleasure. Hitomi

  • hitomi censoredcreampiebig titsPPPDoppaiPPPD-996PPPD996pppd00996
    • 2022-01-14
    120 min

    [BLK-547]Tied Up In The Bitch Room He Was Tied Up, Unable To Move, And Teased Until His Nipples Were Rock Hard, And Tantalized With Pull Out Sex, Until Finally She Relieved Him With An Explosive Nookie! Riho Fujimori

  • riho fujimori censoredbig titsslutBLKkira kirakira kira black galBLK-547BLK547blk00547



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored