school uniform schoolgirl high vision molester censored




FC2MIAASSISGVHBBANWAAAAUKGABWSQTESPRDADNPPPDCESDHMNMVSDSSNINACXJULVENXMEYDAUKS

2020-10-15
55 min

[orex-201]みほ 4

  • amateur censoredcreampieamateurorexorex-201orex201orex-201
    • 2020-10-18
    240 min

    [LAPO-003]Mikako Abe BEST Collection

  • abe mikako censoredcreampiebeautiful girlLAPOla porno daydreamersLAPO-003LAPO003lapo00003
    • 2020-10-22
    76 min

    200GANA-2373 Seriously Nampa, first shot. 1544 Big breasts OL of the healing system that I got at Akasaka Mitsuke! Sensitivity MAX body is incontinence with fingering! I cried too much for comfort! !! Cheating sex secretly to my boyfriend disturbs me

  • amateur censoredamateurganagana-2373gana2373200gana-2373
    • 2020-10-25
    63 min

    413INST-064 Mikan, 18 years old, attending a girls’ school! My first experience is a school teacher ♪ I love Ojisan JD! 1L squirting with fingering! Don’t miss the too beautiful Ahegao and butt! Surprising Smile Cleaning Blow

  • amateur censoredamateurslutinstinst-064inst064413inst-064
    • 2020-11-03
    130 min

    [SDAB-155]"First Creampie At School" First Rule Violation At School! Too Cute And Tits Too Big! Miraculously Colossal I-Cup Tits! Hana Himesaki

  • himesaki hana censoredcreampiebig titsSDABsod createbieber gonzoone s youthSDAB-155SDAB1551sdab00155
    • 2020-11-04
    45 min

    [SHYN-129]SOD Female Employees - Strip Rock-Paper-Scissors - Script Department Challenged Before Their Meeting Akiho Nakayama

  • akiho nakayama censoredbeautiful girlSHYNsod createy 10432sod female employeeSHYN-129SHYN1291shyn00129
    • 2020-11-13
    120 min

    [DASD-755]My Tiny, Pale-Skinned Girlfriend Hates Older Guys, But My Old Man Bred Her Anyway. Hikaru Minazuki

  • hikaru minazuki censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-755DASD755dasd00755
    • 2020-11-13
    151 min

    [MIDE-849]Gaping Wide Deep Throat Face Fucks - Slut Tied Up And Skewered By Cock To Incredible Creampie Orgasms Tsubomi

  • bud censoredcreampiedeepthroatMIDEmoodyzsuisei akaimoodyz divaMIDE-849MIDE849mide00849
    • 2020-11-28
    60 min

    FC2PPV 1586923 ★ Super hot 3P ☆ Creampie orgy with two best daughters ♥ Miya-chan & Yukino-chan ☆ Two bewitching rich lesbian play ♥ Dangerous W Blow blame ♥ Blame and finally cum shot ♥ [Individual Shooting] * With benefits

  • amateur uncensoredfc2
    • 2020-12-01
    66 min

    [SZKK-006]Barely Legal Bodies - R-18 / Nozomi Mita

  • nozomi mita censoredSZKKorustak softSZKK-006SZKK006
    • 2020-12-10
    122 min

    [MOND-205]My Wonderful Brother-in-law - Chinatsu Asamiya

  • chinatsu asamiya censoredsingle workMONDtakara eizodaiichi housouMOND-205MOND20518mond00205
    • 2020-12-14
    76 min

    259LUXU-1357 Luxury TV 1339 A beautiful secretary with a strangely sexy mole on her mouth is here for the first time! The warmth and stimulation of men who are not satisfied in everyday life. In order to regain the pleasure and pleasure as a woman wh

  • amateur censoredamateurmature womanluxuluxu-1357luxu1357259luxu-1357
    • 2020-12-15
    58 min

    Caribbeancom 121520-001 The sex addict business woman who is having sex everyday right after work Aira

  • aira uncensoredcreampiehandjobcaribbeancom
    • 2021-01-08
    70 min

    [RCTS-019]The Ultimate Daydream Item Evolution Series The Dark Side Of Transformation Into Female Skin 3 - A Descent Into Evil Through The Cursed Skin - A Super Evil Woman, Cums With Mask

  • rumi tadami suzuka walnut censoredlesbianRCTSrocketkiyoshi miwaRCTS-019RCTS0191rcts00019
    • 2021-01-11
    39 min

    362SCOH-024 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Thu ● Honzakura]

  • amateur censoredcreampieamateurscohscoh-024scoh024362scoh-024
    • 2021-01-15
    120 min

    [MDTM-697]Always Looking Down On Me. Galactic Beauties' Service Club - Mitsuha Higuchi vol. 002

  • mitsuha higuchi censoredcreampieuniformMDTMuchu kikakutodoMDTM-697MDTM697h-585mdtm00697
    • 2021-01-17
    115 min

    [TIKP-054](The Deflowered Virgin) She Has H-Cup Big Tits And A Lusty, Tight Waist, But She's Seriously A Virgin! We Bust Through That Virgin Membrane In The Creampie Documents!

  • censoredcreampiebig titsTIKPtikitiki.comerTIKP-054TIKP054tikp00054
    • 2021-01-23
    120 min

    [OAE-207]ALL NUDE Izuna Maki

  • izuna maki censoredsingle workOAEaircontrolzaku araiOAE-207OAE207oae00207
    • 2021-01-23
    51 min

    H4610 ori1746 Yuka Oose 23years old

  • amateur uncensoredh4610
    • 2021-01-28
    61 min

    H4610 ki210128 Yuina Kitami 19years old

  • amateur uncensoredh4610
    • 2021-02-20
    46 min

    H0930 ori1594 Yuriko Otomi 36years old

  • amateur uncensoredh0930
    • 2021-02-23
    81 min

    FC2PPV 1698966 CP0073 90cm smooth beauty big breasts beauty man beauty shaved girl rich creampie ❤ super high quality ❤ demon close-up ❤ mirror ❤ 8 turtle ❤ 4K60fps ❤ Cusco ❤ shaved ❤ uncut ❤

  • amateur uncensoredfc2
    • 2021-03-06
    44 min

    FC2PPV 1714556 [Individual shooting] I couldn’t stand the raw Paco erotic body of my super cute niece and I made a vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-03-10
    79 min

    FC2PPV 1720351 * Limited to 2 days * [Superb complete amateur] It was amazing if a serious neat girl working in a large company took off … It would have been even more amazing if I was fucked … A must-see video that can only be found here &

  • amateur uncensoredfc2
    • 2021-03-11
    71 min

    H4610 ki210311 Airi Shinohara 24years old

  • amateur uncensoredh4610
    • 2021-03-12
    218 min

    [SABA-682]New Creampie Raw Footage, S********ls In Uniform Making Money On The Side vol. 005

  • censoredcreampieuniformSABAskyu shirototodoSABA-682SABA682h-244saba00682
    • 2021-03-17
    50 min

    492MERC-288 Chemical Party Video

  • amateur censoredcreampieamateurmercmerc-288merc288492merc-288
    • 2021-03-19
    51 min

    299EWDX-348 Big-breasted housewife who can understand even from the top of clothes does not stop estrus on acme after a long absence!

  • amateur censoredcreampiebig titsewdxewdx-348ewdx348299ewdx-348
    • 2021-03-20
    67 min

    SIRO-4443 [First shot] [Beautiful breasts x obscene] [Beautiful older sister] A woman who can work with a beautiful appearance appears. She turns indecently when her switch is turned on, she can not measure the number of cums .. Application amateur,

  • amateur censoredamateursirosiro-4443siro4443siro-4443
    • 2021-03-25
    110 min

    KDS-001 [Delivery only] Kyun de Shun VOL.1 Sakura 21 years old Take a blowjob selfie with your own camera! ？？ Tohoku <Bitch> Beauty Tokyo’s first landing! !! "I like to see from the perspective of a Gonzo man" What is your Gonzo expe

  • amateur censoredcreampieamateurkdskds-001kds001kds-001
    • 2021-04-01
    55 min

    C0930 ki210401 Yuriko Takasugi 31years old

  • amateur uncensoredc0930
    • 2021-04-17
    239 min

    [REXD-359]We Discovered A Pervert In The Neighborhood! Woman Who Films Herself Masturbating Is Found Out By The Location Of Her Beauty Mark!

  • censoredcreampieblowjobREXDredmanji groupREXD-359REXD359rexd00359
    • 2021-04-17
    78 min

    FC2PPV 1774918 ※ Weekend limited 6000 ⇒ 3980pt ★ Miracle 31 years old ♥ Beautiful wife of dynamite sexy BODY ♥ Yuria-san ☆ Superb beauty big tits big ass ♥ S blow job & footjob ♥ Gonzo messed up cheating pussy mass cum shot [Individual shooting] W

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    243 min

    [NHDTB-524]Girls Okay With Being Groped Special Getting The Thin Beautiful Y********l With A Huge Ass That I Met At The Library To Let Me Feel Her Up Every Day And Cum All Over Her

  • censoredsquirtingschoolgirlNHDTBnatural highitaka smith rimpounderNHDTB-524NHDTB5241nhdtb00524
    • 2021-05-08
    122 min

    [XRL-005]Disciplining A Beautiful Young Wife With Debt Problems With Dirty Talk Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobsingle workXRLreal worksreal real worksXRL-005XRL005xrl00005
    • 2021-06-11
    120 min

    [IPX-670]I Hate My Boss And Would Rather Die Than Fuck Him, But During Our Business Trip, To My Surprise, We Were Booked Into The Same Room At The Hot Spring Resort Inn ... And This Disgusting, Horny Old Man Made Me Cum, Over And Over Again. Rio Kuri

  • rio kuriyama censoredbig titssingle workIPXidea pocketdishIPX-670IPX670ipx00670
    • 2021-06-17
    218 min

    [SORA-317]A Heroine Never Gives Up, Even When She Loses Sarina Kurokawa

  • sarina kurokawa censoredblowjobslutSORAyama to soratelephone poleSORA-317SORA317sora00317
    • 2021-06-19
    100 min

    390JAC-094 [172cm / H Cup God Body x 4 Creampies] Dawn! !! !! Dawn! !! !! Dawn! !! !! In this world, black, white, mamba, and princess are all lonely gals. I will fill the gap in the crotch of such a gal. No, I don’t get any money. If the custom

  • amateur censoredcreampiebig titsjacjac-094jac094390jac-094
    • 2021-07-08
    57 min

    FC2PPV 1911550 Until the 15th [Appearance] Cum swallowing on that child’s bristle pussy that can be understood by those who understand

  • amateur uncensoredfc2
    • 2021-07-14
    135 min

    [MOND-218]Together With My Sexy Boss, Starring Nanami Mineta

  • mineta nanami censoredmarried womansoloworkMONDtakara eizohotate ikkandaiichi housouMOND-218MOND218
    • 2021-07-29
    25 min

    FC2PPV 1945098 [Uncensored] Umeda _ Freeter (I Gave A Vaginal Cum Shot To My Daughter Who Had Trouble Paying Due To Reduced Income In Corona)

  • amateur uncensoredfc2
    • 2021-08-13
    124 min

    [MVSD-474]I Ended Up Sharing A Room With Young Female Graduate With A Slim Waist NTR Special She Let Me Fuck And Come Inside Her Minami Hatsukawa

  • hatsukawa minami censoredcreampiebeautiful girlMVSDm s video groupms video groupMVSD-474MVSD474mvsd00474
    • 2021-08-14
    173 min

    [SORA-329]The Slut Of A Girl Who Wants To Show Her J-Series Outdoor Ejaculation Control. Mahiro Ichiki.

  • mahiro ichiki censoredschoolgirlblowjobSORAyama to soradenchuuSORA-329SORA329sora00329
    • 2021-08-26
    225 min

    [CHN-206]新・絶対的美少女、お貸しします。 105 七嶋舞(AV女優)20歳。 七嶋舞 【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurchnchn-206chn206chn-206
    • 2021-08-30
    118 min

    [RD-1072]Filthy Sex Drama From The Showa Era Playboy Groom Fucks His Wife"s Mother Former Teacher Plots Sexual Conquest In The House Of His Married Former Schoolmate

  • yuri satsuki yoko yamashita censoredmarried womanblowjobRDatena eizouRD-1072RD1072
    • 2021-09-09
    124 min

    [FSDSS-289]I Had Always Loved My C***dhood Friend, And Now I Found Out That She Had Become The No.1 Prostitute ... I Ordered All Of The Available Options And Had Real Sex With Her, With Unlimited Ejaculations, In A 3-Day Fuck Fest Together Arina Hash

  • there is hashimoto censoredbeautiful girlFSDSSfalenomeatfaleno starFSDSS-289FSDSS2891fsdss00289
    • 2021-09-10
    119 min

    [ROE-008]"My Beloved Wife Becomes A Woman After S******g With Stepson..." Midlife Lewd Spouse Drama By MONROE!! Kyoko Ichikawa

  • kyoko ichikawa censoredbig titsmature womanROEmadonnasatsugu koyamamonroeROE-008ROE008roe00008
    • 2021-09-10
    152 min

    [SSIS-179]When Our Little Stepbrother Was Transformed Into A Slender And Beautiful Y********l, We Were Plagued With Feelings Of Conflict, But In The End, We Succumbed To Our Lust And Fucked His Brains Out. Hikari Tamaki

  • wachi subaru censoredbig titsbeautiful girlSSISs1 no 1 stylekyouseiSSIS-179SSIS179ssis00179
    • 2021-10-02
    59 min

    FC2PPV 2287637 [New Work, Half Price! ] ♀299 Professional Student Ma ◯ -Chan 20 Years Old, ♀ 327 Professional Student Sumi ◯ -Chan 20 Years Old 1st Time (3p) First Shot! Once Again, Two Beautiful Girls Who Are Irresponsibly Vaginal Cum Shot In Front

  • amateur uncensoredfc2
    • 2021-10-12
    480 min

    [KTRA-338]Sex with My Short, Lolita-Type Younger Stepsister, 10 Girls, 8 Hours, A Set of 2 DVDs

  • toua kotone risa kudo censoredcreampieKTRAk tribeKTRA-338KTRA338h-094ktra00338
    • 2021-11-10
    129 min

    [HSM-034]New Star! Naturally Beautiful Girly Boy, Hime.Love"s Haruka Asamiya Making Her Porn Debut, She Is A Slender Beauty With Beautiful Legs Who Loves Fucking Despite Her Innocent Looks

  • censoredamateurHSMhime styleHSM-034HSM03459hsm00034
    • 2021-11-11
    200 min

    [STARS-470]いいなり温泉旅行 夏目響

  • natsume hibiki censoredSTARSsod createakai suiseisod starSTARS-470STARS470
    • 2021-11-28
    83 min

    390JNT-033 [6 Pack Abdominal Muscles & Hcup Huge Breasts] I ● Sns Picking Up H Cup Management Consulting To Put Erotic Selfies On The Star! !! Slut Sex With A Terrible Man Pressure Cowgirl With Abdominal Muscles Split Into Six! !! The Super Celebr

  • amateur censoredcreampiebig titsjntjnt-033jnt033390jnt-033
    • 2021-12-04
    124 min

    [BAEM-015]Sister-in-law"s Body That Tempts Men U*********sly. Strong NTR Infidelity From Brother-In-Law She Hates. Yuri Maina

  • yuuri censoredbig titssingle workBAEMbarutanyuuseiemeraldBAEM-015BAEM015baem00015
    • 2021-12-09
    200 min

    [278GZAP-059]乳首イキ媚薬エステ

  • amateur censoredbig titsmarried womangzapgzap-059gzap059278gzap-059



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored