schoolgirl beautiful girl over hours jav school uniform




FC2RBDBLKNACRMIAAPREDSANAUKSEBODKBIWANZAWDHUNTBMVSDPPPDMIDEHNDMEYDSSNISHKDNNPJ

2020-12-20
46 min

S-Cute sdm_007 Gonzo etch with cute indecent / Uta

  • amateur censoredamateursdmsdm-007sdm007sdm-007
    • 2020-12-26
    123 min

    [JKSR-474]10 A.M., What's Up With The School... Erina - Erina Oka

  • hill erina censoredcreampieschoolgirlJKSRbig morkalobockeyprink junkyJKSR-474JKSR47457jksr00474
    • 2021-01-06
    63 min

    SIRO-4383 [First shot] [Back side of serious girls] [Dirty milk x obscene ass] A job hunting junior high school student who looks serious. The super erotic gap SEX, which is contrary to the appearance, is a must-see. Climax many times while waving be

  • amateur censoredamateursirosiro-4383siro4383siro-4383
    • 2021-01-09
    118 min

    [MIMK-082]I Wanna Fuck You No Matter What It Takes! And With That, My Stepmom Agreed To Have Sex With Me. Yu Shinoda

  • shinoda yu censoredcreampiemomMIMKmoodyzcontour stylemankitsuMIMK-082MIMK082mimk00082
    • 2021-01-09
    27 min

    H4610 ki210109 Self Shot

  • amateur uncensoredh4610
    • 2021-02-01
    167 min

    [BBACOS-027](Shame) Babacosplay! (BBA) These Old Wives Are Old But Enjoy The Shame Of Re: Little Stepsister Cosplay (Creampie Sex) First Chapter Ms. Nozomi Haneda 35 Years Old

  • nozomi haneda censoredcreampiebig titsBBACOSplumposting gt jiro in asakusashirouto only plumBBACOS-027BBACOS027h-113bbacos00027
    • 2021-02-06
    117 min

    [ADN-293]Sweaty Sex With A Busty, Innocent Babe From The Countryside. Kana Kusakabe

  • kana kusakabe censoredbig titssingle workADNattackerskitorune kawaguchiotona no dramaADN-293ADN293adn00293
    • 2021-02-10
    22 min

    [SDFK-041]"Couples Only" Inside The Magic Mirror Number Bus, Let Your Beloved Girlfriend Get "Fucked" With Real Creampies! Rie-san (25 Years Old) Occupation: Massage Parlor Therapist

  • censoredSDFKsod createyoshiaki nomotomagic mirrorSDFK-041SDFK0411sdfk00041
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    152 min

    [MDBK-159]Super Closeup! Ultimate Tits Come Again And Again vol. 4

  • an sasakura yamamoto renka censoredbig titslingerieMDBKbazookataro kMDBK-159MDBK159h-1496mdbk00159
    • 2021-02-13
    115 min

    [VENX-007]Whispered Temptation So Daddy Doesn't Hear - MILF Seduces Her Stepson Nao Nakano

  • nanao nakano censoredcreampiebig titsVENXvenuskanyeincestVENX-007VENX007venx00007
    • 2021-02-25
    121 min

    [FSDSS-175]My Girlfriend's Best Friend Drove Me Wild With Her Lips, And For 3 Straight Days, I Kept On Cumming And Having Slobbering Kisses And Creampie Sex Minori Kawana

  • real village henan censoredcreampiebeautiful girlFSDSSfalenoflagmanfaleno starFSDSS-175FSDSS1751fsdss00175
    • 2021-02-25
    45 min

    FC2PPV 1701061 First shot 18 years old ❤️ Kana-chan ❤️ I’m in trouble with a poor gal so please help me! And sorrowful DM❤️ If you don’t show up on Gonzo, it’s OK

  • amateur uncensoredfc2
    • 2021-02-26
    47 min

    FC2PPV 1702015 Until 3/4 980 [No] #Hidden busty Necafe refugee brought into the room and vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-27
    43 min

    FC2PPV 1704523 20-year-old M amateur breeding ♀ Fainting squirting with chestnut blame that moves only the fingertips in small steps! Pursuit Demon Cunnilingus & Neck 〇 Me Convulsions Acme With Uterine Thrust * ㊙ Benefits ☆ Outdoor Man Juice Drip

  • amateur uncensoredfc2
    • 2021-02-27
    105 min

    [PAKO-031]Applying As A Real, Currently Working Cabin Attendant Couple: A Beautiful Wife Fucked In Front Of Her Husband

  • censoredbig titsamateurPAKOmercuryold lady fucking cafeteriaPAKO-031PAKO031h-1133pako00031
    • 2021-03-11
    118 min

    [NEO-755]A Simple Woman - China Chikusa

  • chigusa china censoreddeepthroatsingle workNEOradixshio sakurabaneo radixNEO-755NEO755433neo00755
    • 2021-03-12
    129 min

    [XRW-973]Ravished By Huge Cock - Her Holes Could Rip!

  • censoredbig titsblowjobXRWk m producediran tomimasureal real worksXRW-973XRW973172xrw00973
    • 2021-03-18

    FC2PPV 1731298 Limited to 21 [Uncensored] JD with one experienced boyfriend, first vaginal cum shot with sex for the first time in a long time

  • amateur uncensoredfc2
    • 2021-03-19
    129 min

    [CMV-152]Enema On The Train Female S*****t Devotes Her Beautiful Asshole To Her Bookstore Owner Step Father Mika Takatsuki

  • mika takatsuki censoredbdsmsingle workCMVcinemagicmarukatsuvixenCMV-152CMV152cmv00152
    • 2021-03-20
    90 min

    [KIR-029]My Father's New Wife's Daughter Is A Cute Fashion Girl! Hinako Mori

  • hinako mori censoredcreampiesisterKIRstar paradisekirei star paradiseKIR-029KIR029h-254kir00029
    • 2021-03-22
    113 min

    [NSPS-979]She's Keeping A Secret From Her Husband I'm Receiving Breaking In Training From My Big Brother-In-Law Momo Hazuki

  • hazuki peach censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-979NSPS979nsps00979
    • 2021-04-15
    240 min

    [NASH-494]We Heard That Out In The Country, Farm Wives Work In The Nude! What's More, They Were Down For Three- And Four-Somes And Fucking In The Open Air!

  • censoredbig titsmature womanNASHpinkjun nagasawanadeshikoNASH-494NASH494nash00494
    • 2021-05-12
    160 min

    [GS-2015]Taboo: A Married Woman Opens Her Eyes To Her Sexual Habits 01 - Continued/Married Woman Hot Water Love Trip 129

  • toujou ao nagano sayaka censoredmarried womanGSgostakeshi karakiGS-2015GS2015
    • 2021-05-15
    77 min

    229SCUTE-1118 Maron (24) S-Cute God Breasts Beautiful Body Too Lively Sexual Intercourse

  • amateur censoredcreampiebig titsscutescute-1118scute1118229scute-1118
    • 2021-05-17
    55 min

    318LADY-373 Nene

  • amateur censoredbig titsamateurladylady-373lady373318lady-373
    • 2021-05-20
    144 min

    [RCTD-401]A Dormitory With Completely Naked Female S*****ts

  • karen anba natsuki kisaragi censoredschoolgirlRCTDrocketscarecrowRCTD-401RCTD4011rctd00401
    • 2021-05-31
    66 min

    SIRO-4541 [First shot] [Mochi skin x huge breasts JD] [Waist moves ..] A shy and serious music college student has natural huge breasts. Sensitive she who moves her waist freely when she feels comfortable .. AV application on the net → AV experience

  • amateur censoredbig titsamateursirosiro-4541siro4541siro-4541
    • 2021-06-20
    121 min

    [NEWM-006]Forbidden Fucking With My Mother-In-Law Is Better Than With My Wife... Yu Kawakami

  • yu kawakami morino morino censoredmature womanmomNEWMglobal media entertainmentyayoi nakanonewmomNEWM-006NEWM006newm00006
    • 2021-07-03
    125 min

    [KTB-046]Office Girls Get Groped - Officer Workers Who Get Felt Up And Find Themselves Liking It Edition -

  • censoredbig titsbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-046KTB046ktb00046
    • 2021-07-07
    50 min

    FC2PPV 1882790 [Miracle reunion] [Sequel] Aimi 21 years old! Throat Deep Throat Raw Saddle Massive Facials With Super Big Cock To A Girl Who Is М! !!

  • amateur uncensoredfc2
    • 2021-07-08
    193 min

    [SUN-020]Orgy D***king Cum Surrounded By Dicks, I Just Want to D***k It. I Want To Fuck. Exposure Is Also OK. Convenient

  • mori nanako censoredbig titssingle workSUNsuntanaka baconSUN-020SUN02013sun00020
    • 2021-07-18
    62 min

    FC2PPV 1929271 Limited To July [Nothing] A Debt Wife With Fair Skin. She Is In Trouble With Money, And Although She Hates It, She Is Fucked By Multiple Sticks And Vaginal Cum Shot Is Made Continuously.

  • amateur uncensoredfc2
    • 2021-07-22
    47 min

    FC2PPV 1935867 ☆ New Sale ☆ [Caution For Deletion] The Daughter Sold To Her Mother Can Not Resist And Tears Her Eyes While Playing With Her Undeveloped Body To A Middle-Aged Father And Getting Pleasure

  • amateur uncensoredfc2
    • 2021-08-06
    172 min

    [BNST-033]This Girl Is A Wolf In Sheep"s Clothing, Nozomi

  • censoredblowjobbeautiful girlBNSTteacher delusion groupthere is alsoBNST-033BNST033bnst00033
    • 2021-08-06
    61 min

    1Pondo 080621_001 Hustle Time With A Sexy Girl : Honoka Orihara

  • amateur uncensored1pondo
    • 2021-08-21
    100 min

    [NSFS-021]Posted True Stories: Shared Wife 15 - A Pale Body Devoured By Workers - Hotaru Mori

  • hotaru mori censoredmature womansingle workNSFSnagae stylenagaeNSFS-021NSFS021nsfs00021
    • 2021-08-21
    109 min

    [KBMS-114]Arousing Totally Exposed Strip Dance Show

  • mizumi saki aoi ichigo censoredKBMS1113 koubou mousouzokukobayashi juusanKBMS-114KBMS114
    • 2021-09-02
    54 min

    494SIKA-105 Miraculous Gully Small Tits Beautiful Girl Aheiki In The First 3p

  • amateur censoredschoolgirlamateursikasika-105sika105494sika-105
    • 2021-09-11
    124 min

    [MDTM-739]Complete POV Of The Temptation By, And Sex With, An Honor S*****t, Slut, And Beautiful Girl. Marina Saito

  • marina saito censoredbeautiful girlslutMDTMk m producetodouchuu kikakuMDTM-739MDTM739mdtm00739
    • 2021-09-15
    62 min

    444KING-048 Lala

  • amateur censoredcreampiesquirtingkingking-048king048444king-048
    • 2021-09-16
    68 min

    435MFC-142 [Super SS Rank Extremely Erotic Beauty Body Female College Student] Slender Shaved Big Breasts, The 2nd Round Of Raw Saddle Sex With A Female College Student With The Finest Luxury Specifications That Is Just A Perfect Body! [Shiroto Gonzo

  • amateur censoredcreampiebig titsmfcmfc-142mfc142435mfc-142
    • 2021-09-17
    55 min

    230OREC-882 Nanami

  • amateur censoredcreampieamateurorecorec-882orec882230orec-882
    • 2021-10-03
    47 min

    358WITH-106 Ema (19) S-Cute With Masturbation-Loving Black-Haired Beauty And Gonzo H (Choyo Ema)

  • amateur censoredamateurbeautiful girlwithwith-106with106358with-106
    • 2021-10-04
    62 min

    543TAXD-001 Rina

  • amateur censoredcreampieamateurtaxdtaxd-001taxd001543taxd-001
    • 2021-10-08
    138 min

    [BBAN-344]We Try Swapping To Make Hot, Lewd Lesbian Couples. Giving Her A Sensual Touch From Another Cute Girl. Hotaru Nogi, Riona Minami , Rui Hizuki, Tsubasa Hachino

  • nogi firefly rina minami censoredlesbianBBANbibianBBAN-344BBAN344bban00344
    • 2021-10-24
    38 min

    553APLT-004 Bookmark (Shiori Mochida)

  • amateur censoredbig titsuniformapltaplt-004aplt004553aplt-004
    • 2021-10-25
    45 min

    274DHT-0318 Young Wife Has A Strong Libido! It Is Called A Massage And Seduces By Playing With The Body Of An Acquaintance’s Husband. The Last Is A Couple Exchange Swapping Orgy!

  • amateur censoredcreampiebig titsdhtdht-0318dht0318274dht-0318
    • 2021-11-05
    17 min

    FC2PPV 2404666 [Weekend Limited Release] Wife’s Daytime Cheating Video Robbed From Cheating Partner: Wife Who Refuses Even If She Asks For Sex Spills A Man’s Big Cock At Home [cen]

  • amateur uncensoredfc2
    • 2021-11-11
    122 min

    [FSDSS-321]I Missed The Last Train, But My Coworker Agreed To Let Me Stay Over. The Sight Of Her Loungewear With No Underwear Was Too Much For This Virgin To Resist, And We Ended Up Fucking All Night Starring Nene Yoshitaka

  • nine yoshitaka censoredslutsingle workFSDSSfalenogr3faleno starFSDSS-321FSDSS3211fsdss00321
    • 2021-11-13
    175 min

    [TNOZ-009]105 cm Colossal Tits TSUNDERE Beautiful Girl Leia, 19 "Full Body Erogenous Zone Orgasm Just From Nipples" "Overflowing Saliva French Kiss & Face-Fucking Ejaculation & Pee D***king..."

  • censoredbig titscosplayTNOZall japan amateur photographers union daydream fantasy loversspit uncle 2 all japan kameko cooperative daydream tribeTNOZ-009TNOZ009tnoz00009
    • 2021-11-30
    120 min

    [SAN-028]Intense Taking Advantage Of! Rough Sex. Female Divorcee Working At Massage Parlor Is Turned Into Sex Toy For Clients. Victim No. 001. Miki Maeshima

  • miki maejima censoredsingle workSANmazakisakura kabinmother mazaSAN-028SAN028h-796san00028
    • 2021-12-09
    158 min

    [MIST-357]Butt Hell Level 2 Chisato Shoda

  • shota chisato censoredbig titsmature womanMISTmr michirurassha miyoshiMIST-357MIST3571mist00357
    • 2021-12-16
    62 min

    SIRO-4732 [First Shot] [Sensitive Constitution] [Sexy Lingerie] A Shop Clerk With A Wild And Cool Atmosphere Has Appeared. "It’s Going To Be Weird! !! 』 While Screaming At The Meat Stick That Pierces Violently Many Times, She Shakes Her Legs

  • amateur censoredamateursirosiro-4732siro4732siro-4732
    • 2021-12-16
    102 min

    [KEED-071]娘が不在中、娘の彼氏に無理やり中出しされ発情した彼女の母親 豊永映美

  • emi toyonaga censoredKEEDcenter villagejiro fukagawahanazono center villageKEED-071KEED071h-086keed00071
    • 2021-12-31
    174 min

    [DVDMS-756]International Flight Attendant Aina Mizuki (Age 24) Does Her Secret AV Debut On The Side! Documenting This Employed Woman Making Her AV Appearance. Tall 170cm Height And Slender Beautiful Legs In Flight Attendant Black Pantyhose, Which She

  • mizuki aina censoredsingle workDVDMSdeep ssuttorune iwanagaDVDMS-756DVDMS756dvdms00756



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored