shame censored high vision various occupations




FC2ABWPPPDDASDAUKGHZGDNACXGMEMRBDAPODMIDVIPXCAWDMIAASPRDDASDSHKDMIDEMEYDNNPJNGOD

2020-11-01
134 min

[SQTE-337]A Lewd Woman's Slimy Boobs: This Body Is My Strongest Weapon - Rika Tsubaki

  • tsubaki rika censoredbig titsblowjobSQTEs cuteSQTE-337SQTE337sqte00337
    • 2020-11-08
    61 min

    413INST-068 Kozue-chan, 18 years old ☆ “I’ll do my best ♪” Black-haired neat and clean pettan beautiful girl research student who dreams of being a full-fledged idol ☆ Toilet bowl fallen SEX to be vaginal cum shot ♪

  • amateur censoredcreampieamateurinstinst-068inst068413inst-068
    • 2020-11-18
    134 min

    [GVH-149]A Woman Possessed By Exhibitionist/G*******g/Bukkake Urges Miki Sunohara

  • future sunohara censoredslutsingle workGVHglory questusubashisuiGVH-149GVH14913gvh00149
    • 2020-11-27
    120 min

    [NEM-049]New Kinky Sex 3 - MILF In Her Fifties Finds Her Stepson's Porn And Gets Horny Keiko Isoyama

  • keiko isoyama censoredmature womanmomNEMglobal media entertainmentyayoi nakanonewmomNEM-049NEM049143nem00049
    • 2020-11-29

    FC2PPV 1588074 Limited number [No] Male experience continuous vaginal cum shot to one nursing student (47 minutes)

  • amateur uncensoredfc2
    • 2020-12-01
    123 min

    [AMBI-115]My Homeroom Teacher And Me Are Living A Secret Lovey-Dovey Newlywed Sex Life Together Urara Kanon

  • hanaoto urara censoredcreampieschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-115AMBI115h-237ambi00115
    • 2020-12-08
    126 min

    [KTRA-260]My Stepsister's Little Tits Are Making Me Horny Hinako Mori

  • hinako mori censoreduniformschoolgirlKTRAk tribeKTRA-260KTRA260h-094ktra00260
    • 2020-12-15
    243 min

    [SDJS-099]We Picked The Most Popular Pairs Of Titties For Our Annual Bathing Suit Competition - The Bustiest Babes In The Company Vie For The Title Of Best Boobs! SOD Female Employees

  • yumi kodama ayano goto censoredbig titsSDJSsod createchain sousod female employeeSDJS-099SDJS0991sdjs00099
    • 2020-12-27
    62 min

    413INST-082 [Amateur 3P individual shooting] E-cup beauty busty teacher and 3P individual shooting Photo session at La ○ live costume → Massive vaginal cum shot ♀ complete appearance publicly released by college students at the hotel until fainting [

  • amateur censoredcreampiebig titsinstinst-082inst082413inst-082
    • 2021-01-01
    96 min

    [VENU-996]I Can't Live Without My Stepson... Sexy Stepmoms Indulge In the Ultimate Erotic Creampie Fucks - 50 Incredible Orgasms Yu Shinoda

  • shinoda yu censoredcreampiebig titsVENUvenuspeterfakecest winntersVENU-996VENU996venu00996
    • 2021-01-06
    134 min

    [GVH-176]Pussy Device Bondage XIX - Tied Up In Chains For Vaginal Agony Akane Shiki

  • akane shiki censoreddeepthroatsingle workGVHglory questGVH-176GVH17613gvh00176
    • 2021-01-09
    71 min

    FC2PPV 1634646 [Personal shooting] [No] Sex with an erotic erotic older sister who is squirting squirting! !! High-quality ZIP, Blow and Masturbation (57 minutes) can be downloaded as a review privilege

  • amateur uncensoredfc2
    • 2021-01-15
    119 min

    [MBMH-026]Do You Not Like A Naughty Fifty-Something Babe？ (She's Making Her Dreams Cum True By Starring In An Adult Video) Passionate, Lusty Sex 5 Mature Woman Babes With Rising Sensual Temperatures 2

  • censoredcreampieamateurMBMHprestigesasazuka garoumbmMBMH-026MBMH026118mbmh00026
    • 2021-01-20
    115 min

    [EMOI-045]Creampie POV / Her First Time Swallowing Cum In A Blowjob / First Time Showing Her Face With No Makeup / Frank 1-to-1 Talk / Beach Date In Shonan / Mao Watanabe (20)

  • mao watanabe censoredcreampieEMOIsod createtanaka baconemo girlEMOI-045EMOI0451emoi00045
    • 2021-01-22
    65 min

    [orex-191]まや 2

  • amateur censoredcreampieamateurorexorex-191orex191orex-191
    • 2021-01-29
    28 min

    FC2PPV 1663634 Get an obedient pet! Handcuffs ● & Embarrassing armpit show Blow sperm is ejected ♥ Raw Saddle second round that does not stop!

  • amateur uncensoredfc2
    • 2021-02-12
    43 min

    [DHT-233]A Mature Woman And Wife In The Reiwa Era With Plenty Of Issues Is Going On A One-Day Adultery Sex Journey Asami 43 Years Old

  • censoredbig titsmarried womanDHThot entertainmententhusiastDHT-233DHT23359dht00233
    • 2021-02-15
    180 min

    [DIPO-089]Top Secret Hidden Camera Footage Leaked Online! Middle-Aged Man Secretly Filmed His Sweaty Sex With A Married Woman With Colossal Tits 5 - Innocent Married Hottie Seduced By His Smooth Moves...

  • censoredbig titsmarried womanDIPOprimoheronandezDIPO-089DIPO089h-283dipo00089
    • 2021-02-20
    106 min

    [YSN-541]It Makes Me Happy When A Young Nubile Girl Likes Me, But Since She Knows I'm Horny, She Likes To Tease Me, And Get Me Super Rock Hard, And I Have No Idea Where She Learned Her Techniques, But She's Draining My Balls Dry 2

  • really yuki hiraoka censoredblowjobYSNnonYSN-541YSN541h-127ysn00541
    • 2021-02-26
    77 min

    [hoi-162]みれい

  • amateur censoredamateurbeautiful girlhoihoi-162hoi162hoi-162
    • 2021-03-06
    161 min

    [JUL-492]15 Years Of Boring, Mundane Marriage Led To Her "Submissive Desires" Mizuki Narasaki 43 Years Old AV Debut.

  • mizuki narasaki censoredsquirtingmature womanJULmadonnamametaro mamezawaJUL-492JUL492jul00492
    • 2021-03-07
    54 min

    490FANE-32 Hana 2

  • amateur censoredcreampiebig titsfanefane-32fane32490fane-32
    • 2021-03-12
    39 min

    480FRIN-023 《Personal shooting》 Soft figure skating female player 18 years old Secret meeting with coach Private SEX leaked

  • amateur censoredcreampiebig titsfrinfrin-023frin023480frin-023
    • 2021-03-13
    119 min

    [EBOD-812]More Than Masturbation But Less Than Lovers Sexfriend With Beautiful Tits And A Tight Pussy Lets Me Fuck Her When We Meet - Rui

  • censoredcreampiebig titsEBODe bodymichiru arashiyamaEBOD-812EBOD812ebod00812
    • 2021-03-15
    70 min

    491TKWA-163 Brown Half J ○ With Outstanding Style And Raw Creampie Video

  • amateur censoredcreampiebig titstkwatkwa-163tkwa163491tkwa-163
    • 2021-03-25
    123 min

    [FSDSS-194]Her Pussy's On Fire With Pleasure - Screams Of Delight At A Naughty Oil Massage Parlor Arina Hashimoto

  • there is hashimoto censoredsingle workFSDSSfalenogoemonfaleno starFSDSS-194FSDSS1941fsdss00194
    • 2021-03-31
    57 min

    292MY-454 Honda Minami 2

  • amateur censoredcreampiemarried womanmymy-454my454292my-454
    • 2021-04-15
    153 min

    [MMKZ-094]A Cute Face And A Huge Ass!! Sarina Kurokawa

  • sarina kurokawa censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-094MMKZ094mmkz00094
    • 2021-04-28
    55 min

    517MQXT-010 Enema Climax Daughter Who Explodes To The extent That It Goes Mad

  • amateur censoredanalamateurmqxtmqxt-010mqxt010517mqxt-010
    • 2021-05-01
    148 min

    [GOJU-178]Begging To Deep Throat That Huge Cock She's Always Dreamed Of! Beautiful Older Woman Orgasms From Both Her Mouth And Pussy

  • censoredsquirtingamateurGOJUfifty somethingGOJU-178GOJU178h-1165goju00178
    • 2021-05-14
    120 min

    [SSIS-066]I Was Peeping On My Neighbor, An Elder Sister Type With Beautiful Legs With Whom I Was Infatuated, And On The 5th Day, She Finally Caught Me In The Act ... So She Lured Me To Temptation And Fucked My Brains Out Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSISs1 no 1 stylekitorune kawaguchiSSIS-066SSIS066ssis00066
    • 2021-06-01
    108 min

    [GASW-013]Amateur I-Cup Virgin Anzu Miura I Want To Feel Good

  • miura apricot censoredbig titsamateurGASWcinema unit gasa tgasGASW-013GASW01371gasw00013
    • 2021-06-04
    86 min

    [ETQR-243](Breaking In POV) Married Woman Wants To Get Knocked Up By A Massive Cock Karina, Age 33

  • censoredcreampiemarried womanETQRerotic timeETQR-243ETQR243etqr00243
    • 2021-06-10
    160 min

    [MIST-340]Private Titty Pub - Her Employer's At Risk Of Going Out Of Business, So One Of The Hostesses Agrees To Meet With Just The Two Of You... And Offers You Creampie Sex On The Down-Low Hazuki Wakamiya

  • wakamiya censoredcreampiebig titsMISTmr michirusaitaMIST-340MIST3401mist00340
    • 2021-06-12
    122 min

    [NASH-521]Stepfamily - Stepson Has A Stepmom-Complex And Cums In Her Pussy

  • censoredcreampiemature womanNASHnadeshikoNASH-521NASH521nash00521
    • 2021-06-13
    66 min

    FC2PPV 1867550 19-year-old city hall employee with idol-class looks. She has a beautiful face and is sticky with plenty of semen.

  • amateur uncensoredfc2
    • 2021-06-16
    150 min

    [BLK-503]This Sugar Baby Doesn't Normally Like Older Guys, But When This Hung DILF Pounds Her Hard She Loves Every Minute! "His Dick Was So Droopy... Now It's Rock Hard!

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-503BLK503blk00503
    • 2021-06-17
    119 min

    [MRSS-114]My Beloved Wife Has Been Taking Creampies From My Playboy Coworker - I Found Their Fuck Videos Saved On Her Phone Natsuki Takeuchi

  • natsuki takeuchi censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-114MRSS114mrss00114
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    138 min

    [CEMD-027]Aika Is Dripping Massive Amounts Of Pussy Juice While Panting And Moaning In Ecstasy! She Said She Liked It Rough, But The Way She Kept Cumming Hard Was Next Level Stuff, And It Was Blowing My Mind!

  • censoredbig titsmature womanCEMDceleb no tomoCEMD-027CEMD027cemd00027
    • 2021-07-10
    119 min

    [SABA-708]"I'm quitting school because I got knocked up by an old guy..." A story of the pure love between a filthy horny nympho in a school uniform and an old guy's massive cock she was captivated by. G-cup Misa (pseudonymn)

  • censoredcreampiebig titsSABAskyu shirototodoSABA-708SABA708saba00708
    • 2021-07-10
    129 min

    [BAEM-011]Naughty Young Lady's Impure Love Sakura Tsuji

  • sakura tsuji censoredcreampiebeautiful girlBAEMbaltandaibutsu yoshidaemeraldBAEM-011BAEM011baem00011
    • 2021-07-17
    119 min

    [JUL-657]The Conversion of a Married Woman. Momoko Isshiki.

  • momoko isshiki censoredmature womansingle workJULmadonnajyoji kawaiJUL-657JUL657jul00657
    • 2021-07-31
    136 min

    [FLAV-277]The Sexy Amateur Women In Masks Have Plump, Colossal Tits And Big Asses, And They Are Sluts Who Gratify Our Sexual Desires

  • censoredamateurFLAVdigital arkdigital ark dejitarua kuFLAV-277FLAV277flav00277
    • 2021-07-31
    57 min

    HEYZO 2577 Orgasms With A Horny Pussy Girl Vol.20 – Nana Kamiyama

  • nana kamiyama uncensoredcreampieheyzo
    • 2021-08-06
    150 min

    [MIAA-487]The Petite Girl Is Matting Pressed By A Fan With A Huge Dick That Came To A Photo Shoot.

  • censoredcreampiedeepthroatMIAAmoodyzakai suiseiminna no kikatanMIAA-487MIAA487miaa00487
    • 2021-08-12
    124 min

    [FSDSS-329]120 Minutes Of A Girl At The Creampie Baths Who Has Superior Techniques And Squeezes Out Semen Without End, Sora Shiina

  • shiina sky censoredcreampiesingle workFSDSSfalenoseijoui ishiifaleno starFSDSS-329FSDSS3291fsdss00329
    • 2021-08-13
    124 min

    [MVSD-474]I Ended Up Sharing A Room With Young Female Graduate With A Slim Waist NTR Special She Let Me Fuck And Come Inside Her Minami Hatsukawa

  • hatsukawa minami censoredcreampiebeautiful girlMVSDm s video groupms video groupMVSD-474MVSD474mvsd00474
    • 2021-08-16
    71 min

    [MISG-003]Creampie Sex With A Girl Who Is Annoyed For Some Reason And Treats Me Coldly Yu Shinoda

  • shinoda yu censoredcreampiebig titsMISGstimulation strongjohnny shibuyaMISG-003MISG003misg00003
    • 2021-08-20
    65 min

    FC2PPV 2050468 An 18-Year-Old Former Underground Idol Who Has Been Appointed As A Local Idol. She Enjoys The Fair-Skinned Body That Is Too Beautiful And The Mature Beautiful Breasts Again. After A Large Amount Of Squirting While Looking At The City V

  • amateur uncensoredfc2
    • 2021-08-20
    51 min

    FC2PPV 2050617 Men’s Esthetic Training Hidden Shooting (Karen 24 Years Old) -Silver ● Slowly Attack An Elegant Fair-Skinned Beauty Nail Technician Who Works At A Luxury Salon With A Hand Man And Insert It Raw Into A Sloppy Maco

  • amateur uncensoredfc2
    • 2021-08-24
    115 min

    460SPCY-021 [20 Years Old Kanagawa Prefecture] Yui

  • amateur censoredcreampiebig titsspcyspcy-021spcy021460spcy-021
    • 2021-08-26
    227 min

    [SW-794]"Let"s Share A Bath!" Cousin"s Step-sisters Who Teases Me Shows Their Big Tits Off In Our Bath Together! Dick Reacts In No Time To Fondling And Bathing Breasts. Keeping It Hidden And Trying Hard Not To Cum!

  • censoredbig titsSWswitchyocchanswitch hibinoSW-794SW7941sw00794
    • 2021-09-04
    123 min

    [BIJN-206]The Documenting Of Full Climax Of A Cute Little Devil Wife Jerking And Screaming While Cumming Madly Mitsuki Nagisa

  • scooping censoredcreampiesingle workBIJNbijin majoBIJN-206BIJN206bijn00206
    • 2021-09-16
    57 min

    FCP-042 [Delivery Only] Instead Of Angry Waves, Double Facial Cumshots! !! The Limit To Squeeze Until Empty! 2

  • amateur censoredamateurslutfcpfcp-042fcp042fcp-042
    • 2021-09-23
    67 min

    SIRO-4639 [First Shot] [Active Nursery Teacher] [H Cup Married Woman] Discovered A Married Active Nursery Teacher With A Wonderful Healing Smile Full Of Motherhood. The Body That Was Hungry For Being Blamed Receives The Relentless Caress Of A Man And

  • amateur censoredbig titsmarried womansirosiro-4639siro4639siro-4639



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored