shaved nampa jav javcensored amateur




FC2WAAAMIAAGVHCHRVMILKSSNINGODJULONEZPPPDHDKAADNSTARSNATRMIDVSQTECESDNACRSHKDVENX

2020-10-17
159 min

[JJBK-036]Mature Women Only! Mature Woman Comes Into My Room, Takeaway Voyeur As-IS AV Release 34 With Forty-Something Explosive Titties! Full of Libido! Mature Women Eat-Out Edition With Miss Masumi (I cup, 45 Years Old) And Miss Kelly (G Cup, 40 Ye

  • censoredcreampiemature womanJJBKjukujo bank emmanuellemanji groupJJBK-036JJBK036jjbk00036
    • 2020-10-23
    61 min

    Caribbeancom 102320-001 Halloween DE Too Much Cum Pussycat – Heaven After Heaven Runa Hinata

  • runa hinata uncensoredcreampiecaribbeancom
    • 2020-11-01
    119 min

    [JKNK-114]If You Suddenly Show Off To A Married Woman In The Middle Of Shopping...

  • censoredmature womanJKNKjuku no kura emmanuellejuku no kuraJKNK-114JKNK114jknk00114
    • 2020-11-07
    239 min

    [MLSM-033]Top Class Hot Mature Highlights Chisato Shoda 4 Hours, Voluptuous Beauty! 2

  • shota chisato censoredcreampiebig titsMLSMmellow moonMLSM-033MLSM033mlsm00033
    • 2020-11-07
    191 min

    [CMC-246]Cinemagic Catalog DVD 2019 - 2020

  • censoredCMCcinemagictakashi shirorakucollectCMC-246CMC246cmc00246
    • 2020-11-19
    120 min

    [OKSN-309]Adulterous Pleasure - She Might Be A Married Woman Now, But She's Still A Slut At Heart - Former Cum Dumpster Bumps Into An Old Flame For Passionate Creampie Sex

  • censoredOKSNabc mousouzokuokasan.comOKSN-309OKSN309oksn00309
    • 2020-11-23
    201 min

    [HPOW-006]Her Parents Would Cry If They Saw This Video. Volume 6. Kinky, Passionate Sex With A S********l With Colossal Tits - Teen Amateur, Beautiful Girl, Passionate Sex, School Uniform, Clothed Sex, Cum Swallowing, Spit Swallowing, Intimate, Lovin

  • censoredbig titsschoolgirlHPOWamateur seduction daydream familyHPOW-006HPOW006hpow00006
    • 2020-11-29
    266 min

    [GAV-055]The Boobs Of A Girl So Beautiful She's A National Treasure vol. 3

  • censoredcreampiebig titsGAVgogo adult videosGAV-055GAV055gav00055
    • 2020-12-18
    110 min

    [MKD-220]Sure Lures Men In With Her Exotic Gaze - Lady Leopard In Her Fifties Makes Her Porn Debut! Sara Kuroki

  • sara kuroki censoredmature womansingle workMKDrubymaterukazu umiyamaMKD-220MKD220mkd00220
    • 2020-12-24
    124 min

    [SPRD-1359]Journey: A Stepmom's Trip Alone With Her Stepson - Rieko Hiraoka

  • rieko hiraoka censoredmature womanmomSPRDtakara eizorokusaburo mishimaaleddinSPRD-1359SPRD135918sprd01359
    • 2020-12-29
    59 min

    Pacopacomama 122920_406 Rinka Mizuhara

  • rinka mizuhara uncensoredcreampieblowjobpacopacomama
    • 2021-01-01
    240 min

    [SOUD-020]Steamy Hot Spring Sex! Amateur Babes Dripping Sweat And Hot Water While They're Drilled In This Hot Spring Special!

  • censoredamateurSOUDprestigesaikyou chome chomeSOUD-020SOUD020118soud00020
    • 2021-01-04
    42 min

    FC2PPV 1632103 [Personal shooting] No.026 Yuka-chan ★ A cute beautiful girl with black hair. I am very excited about Jubojubo Blow and violent hip swing ★ [Complete appearance]

  • amateur uncensoredfc2
    • 2021-01-08
    605 min

    [SVOMN-151]One-Way Mirror Cab - Hard Boiled 2020 Productions Lucky Bag! 2 Discs, 10 Hours, 69 Amateur Girls, 17 Titles

  • censoredsquirtingamateurSVOMNsadistic villagesadie bestSVOMN-151SVOMN1511svomn00151
    • 2021-01-11
    42 min

    362SCOH-031 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Ze ● Two]

  • amateur censoredcreampieamateurscohscoh-031scoh031362scoh-031
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    51 min

    FC2PPV 1647696 [Individual shooting] Connected to the dangerous back dirt J system famous for SNS and immediately squirrel halo ・ I can not stand it with more erotic pussy than rumors

  • amateur uncensoredfc2
    • 2021-01-20
    135 min

    [GVH-182]Anal Teacher III: Naoko Akase/Meiko Nakao

  • naoko akase meiko nakao noa censoredanalslutGVHglory questchintaGVH-182GVH18213gvh00182
    • 2021-02-02
    64 min

    300NTK-512 Doujin Circle Crusher Beautiful Girl’s Nice Bottom Shivering Gachi Ascension SEX! !! A greedy writer who is on the look of a crazy erection! ？？ Cheer on Echiechi fingers & Den Maona with fingering! !! The long-awaited old man seri

  • amateur censoredcreampieamateurntkntk-512ntk512300ntk-512
    • 2021-02-07
    119 min

    [HKD-132]I Became A Captive Of My Step-grandson's Body: Suzuhana Ukyo

  • ukyo suzuhana censoredmature womansingle workHKDrubysuke kato 6mama rubyHKD-132HKD132hkd00132
    • 2021-03-03
    52 min

    432YKMC-052 Miki (22)

  • amateur censoredcreampiebig titsykmcykmc-052ykmc052432ykmc-052
    • 2021-03-09
    54 min

    FC2PPV 1699799 [Personal shooting] Innocent shaved busty plump daughter Maho-chan with a large amount of raw vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-03-11
    57 min

    H0930 ki210311 Akiko Tachihara 27years old

  • amateur uncensoredh0930
    • 2021-03-16
    47 min

    FC2PPV 1728986 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] Stress release with decachin! F cup woman working at a high-class Japanese restaurant ♥ ️ Massive vaginal cum shot! !! ♥ ️ ※ Review privilege / Ufufu masturbation with Denma ♥

  • amateur uncensoredfc2
    • 2021-03-30
    42 min

    [MNSE-014](Online Only) College Call Girl - Creampie Sex OK! Miyabi - The Call Girl Who Came To Your Hotel Was Your C***dhood Friend! A Titty Fuck From Beautiful Tits, This G-Cup Is Ready To Get Fucked! - Miyabi Yurikawa

  • yurikawa masa censoredcreampiebig titsMNSEcrystal picturemaniac plusMNSE-014MNSE014mnse00014
    • 2021-04-10
    182 min

    [SQIS-047]Indoor Sex Scenery: MILFs, Wives, Stepdaughters, Housewives

  • censoredbig titsmature womanSQISfa proSQIS-047SQIS047sqis00047
    • 2021-04-15
    100 min

    [KIRM-004]"I'm Sorry Step Brother..." Step Sister Fucked Raw Over And Over To Save Her Step Brother From Loan Sharks Chiharu Miyazawa

  • chiharu miyazawa censoredcreampieKIRMsanji s side dishdeep throatingit s a real vaginal cum shotKIRM-004KIRM004h-1540kirm00004
    • 2021-04-29
    57 min

    FC2PPV 1794118 Until 5/9 2000off Fair-skinned D cup Kanawo 2nd round

  • amateur uncensoredfc2
    • 2021-04-30
    52 min

    FC2PPV 1795505 * Weekend limited 3980⇒2980pt ★ First 3P ♥ I love Ochinchin! Etsuko-chan, a beautiful erotic girl, 23 years old ☆ Natural bristle pussy ♥ Lust for the first W blowjob ♥ Gachi raw squirrel continuous vaginal cum shot ♥ * With special be

  • amateur uncensoredfc2
    • 2021-05-07
    120 min

    [EBOD-823]Ginza's No. 1 (Famous High-Class Club) H-Cup Hostess - Her First Ever Creampie, First Raw Cock, First Carnal Awakening! 3 Intense, Orgasmic Fucks Mina Kitano

  • mina kitano censoredcreampiebig titsEBODe bodyichigoharaEBOD-823EBOD823ebod00823
    • 2021-05-22
    68 min

    SIRO-4534 [First shot] [Cum convulsions body] [Foolery that dies] A slender beauty who fascinates the mermaid-like bounce on land. Her facial expression is sensual, and she climaxes many times .. AV application on the net → AV experience shooting 154

  • amateur censoredamateursirosiro-4534siro4534siro-4534
    • 2021-06-10
    228 min

    [SVDVD-857]A Massive Plan To Milk This Married Woman Of All Her Squirts! This Married Woman Came For A Consultation Because She Was Being Neglected By Her Husband, And Decided To Take On The "You'll Win 1 Million Yen If You Can Squeeze Out Al

  • censoredcreampiebig titsSVDVDsadistic villagenew kage kazamaamateur variety showSVDVD-857SVDVD8571svdvd00857
    • 2021-06-12
    138 min

    [CEMD-017]Teased To Hell! Cumming Too Hard! Made To Orgasm With The Strongest Black Magic! Kana Morisawa

  • kana morisawa kanako iioka censoredblowjobmature womanCEMDceleb no tomoCEMD-017CEMD017cemd00017
    • 2021-06-13
    77 min

    200GANA-2500 Seriously Nampa, first shot. 1648 Even though it’s so cute! A sad beautiful girl who was afraid to make a boyfriend because of the shock that her ex-boyfriend had an affair with her friend! It’s usually quiet, but when it comes

  • amateur censoredamateurbeautiful girlganagana-2500gana2500200gana-2500
    • 2021-06-25
    12 min

    FC2PPV 1870786 [4K] Overwhelming Feratech! Moe-chan’s Big Cock Swallowing Cum Blow Personal Shoot

  • amateur uncensoredfc2
    • 2021-07-02
    124 min

    [JUL-645]Horny Pregnant Stepmom Rides My Cock For A Creampie Behind The Old Man's Back Ai Mukai

  • ai mukai censoredcreampiemature womanJULmadonnabieber gonzoJUL-645JUL645jul00645
    • 2021-07-24
    54 min

    [DANDAN-006]"This Old Lady Can't Wait..." The Sensual Therapist In A Legit Massage Parlor That Invites A Boner. Her Secret Option That Leaves You Breathless. Miss Mina ( 30 Years Old) I Cups.

  • censoredbig titshandjobDANDANdandytanaka baconDANDAN-006DANDAN0061dandan00006
    • 2021-07-30
    138 min

    [ATID-472]Midsummer Fuck: Anally Fucking My Daughter-in-law While My Wife Is Away Yui Kawagoe

  • yui kawagoe censoredanalsingle workATIDattackerstakuo ohtaniin madATID-472ATID472atid00472
    • 2021-08-01
    238 min

    [ZMAR-047]Marutto! Aira Hatta

  • yurika censoredcreampiemarried womanZMARplanet plusmaruttoZMAR-047ZMAR047h-237zmar00047
    • 2021-08-13
    75 min

    374IMGN-019 Noai

  • amateur censoredcreampiebig titsimgnimgn-019imgn019374imgn-019
    • 2021-08-20
    119 min

    [HMN-037]My Quiet Classmate From Junior High Turned Into A Total Sex Fiend When I Met Her 5 Years Later, Starring Maika

  • censoredcreampiebeautiful girlHMNhonnakaHMN-037HMN037hmn00037
    • 2021-08-22
    115 min

    [083PPP-2216]総勢32人！くっそエロい3P

  • amateur censoredbig titsamateurpppppp-2216ppp2216083ppp-2216
    • 2021-09-03
    217 min

    [DVDMS-711]A Normal Boys And Girls Focus Group Adult Video In This Special Edition, We Follow A Clan That Fucks Together, And Watch Happens Afterward On The Other Side Of That Magic Mirror Is Her Loving Stepfather! A Big Tits Stepmom And Sch**lgirl L

  • censoredcreampieamateurDVDMSdeepspoolsideDVDMS-711DVDMS711dvdms00711
    • 2021-09-17
    97 min

    529STCV-015 Hana

  • amateur censoredcreampiesquirtingstcvstcv-015stcv015529stcv-015
    • 2021-09-17
    110 min

    [KAM-090]Amateur NTR I Seduced My Son"s Wife And Fucked Her And Posted The Sex Video Online. I Was So Excited At Her Huge Tits That I Came A Lot Inside Her

  • censoredcreampiebig titsKAMkarumagroupKAM-090KAM090kam00090
    • 2021-10-01
    151 min

    [MIAA-504]Cheating On My Wife With The Most Beautiful And Obscene Top Class Hostess, Who Makes Me Lose My Mind And Cum Inside Her Starring Mina Kitano

  • mina kitano censoredcreampiebig titsMIAAmoodyzmamezawa mametarouminna no kikatanMIAA-504MIAA504miaa00504
    • 2021-10-02
    240 min

    [YMDD-247]Thank You! Nacchan ! Endless J Cup Super Colossal Tits Fuck Doll! Natsuko Mishima Retirement Highlights

  • natsuko mishima censoredcreampiebig titsYMDDmomotaro video publishingdr ishikiri bridgeyoung peachYMDD-247YMDD247ymdd00247
    • 2021-11-11
    166 min

    [NHDTB-600]A Female S*****t Sweating In A Closed Room Who Starts Feeling Horny Even Though She Hates Being Licked

  • censoredsquirtingschoolgirlNHDTBnatural highsymmetry nakataNHDTB-600NHDTB6001nhdtb00600
    • 2021-11-16
    123 min

    [KTRA-343]Sister With Colossal Tits Asuka Rina

  • asuka riina censoredcreampiebig titsKTRAke toraibuk tribeKTRA-343KTRA343h-094ktra00343
    • 2021-12-03
    171 min

    [HZ-009]I Said To This Elder Sister Type Cosmetics Sales Lady In Ginza, Your Body Is A Crime ... It Should Be Illegal ... "And To Make Matters Even Worse, You Look Just Like Nanako Matsu****？" 23 Years Old Azusa Tani "Would You Like To To

  • azusa tani censoredcreampiebig titsHZplumgajiro asakusashirouto only plumHZ-009HZ009h-113hz00009
    • 2021-12-03
    120 min

    [SHKD-977]I Love My Big Sister, But When I Watched My Classmate Bullies Fuck Her And Pass Her Around, I Started Feeling Horny ... (Sob) All I Could Do Was Pretend Not To See It Happen. Hikari Ninomiya

  • hikari ninomiya censoredcreampiebeautiful girlSHKDattackersjo styleshi yoru akuSHKD-977SHKD977shkd00977
    • 2021-12-16
    138 min

    [AKDL-156]Intense Ejaculations! She Won"t Be Satisfied With Only One! I Was Drained Dry By Her Wild Blowjobs And Handjobs

  • takashiki wakamiya censoredbig titsbeautiful girlAKDLakinoriaknrAKDL-156AKDL1561akdl00156
    • 2021-12-28
    44 min

    H4610 ki211230 Shizuko Oka 22years old

  • amateur uncensoredh4610
    • 2021-12-31
    48 min

    10musume 010122_01 Happy New Year! I Came To Cleanse Your Penis For The New Year Kozue Kurihara

  • amateur uncensored10musume
    • 2021-12-31
    86 min

    529STCV-050 Cuckold Cuckold Cuckold Wife! The Celebrity Wife Who Lives In The 6LLDDKK Mansion Is A Former Bridal Planner Of The Groom Killer! If The House Is Big, The Milk Is Big! "Sex Like This For The First Time In A While …" Planning

  • amateur censoredcreampiebig titsstcvstcv-050stcv050529stcv-050
    • 2022-01-01
    56 min

    491TKWA-207 Her 4 Kudo Lara Out In This Daughter

  • amateur censoredcreampieamateurtkwatkwa-207tkwa207491tkwa-207



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored