shrimp




FC2EBODHUNTBRBDMARAMIAAHODVNACRSANABWFSDSSSHKDHMNSQTEWAAAMIDVCHRVDASDKBIAMBIAUKG

2020-11-17
51 min

330PER-338 Saya

  • amateur censoredamateurslutperper-338per338330per-338
    • 2020-11-20
    125 min

    [ARM-925]Ball Rejuvenation Plus Cock Massage

  • tachibana mary yuno mizusaki censoredsluthandjobARMaroma planningmania satoshiaromaARM-925ARM925arm00925
    • 2020-11-28
    120 min

    [WAAA-018]A Creampie-Addicted Cum Bucket Woman Who Has Men Lining Around The Block To Partake Of Her Services 20 Consecutive Large Orgies With Rich And Thick Dirty Old Men Semen In Follow-Up Impregnation Fucks Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiedeepthroatWAAAwanz factorywanzWAAA-018WAAA018waaa00018
    • 2020-12-14
    125 min

    [ARM-933]Noa Eikawa's All-POV Masturbation Support - Trembling Right Down To Her Anal Hole!

  • sakaegawa noa censoredanalsingle workARMaroma planningmania satoshiaromaARM-933ARM933arm00933
    • 2020-12-21
    107 min

    [DUVV-031]We Discovered This Music S*****t In Akita, And Now She's Making Her Pregnant Adult Video Debut Ichika Hasumi

  • hasumi ichika censoredcreampiebig titsDUVVtoyohikotoyohikotoyohiko planningDUVV-031DUVV031duvv00031
    • 2020-12-25
    119 min

    [AOZ-294]Female S*****ts Targeted By A Group Of Men For Outdoor Rough Sex

  • censoredAOZaozora softAOZ-294AOZ294
    • 2020-12-26
    123 min

    [HMGL-186]Beautiful Campaign Girl Again 18 - Wakana Ruito

  • rui miura shiroyama wakana censoredbig titsHMGLhmjmcompany matsuoglamourHMGL-186HMGL186h-172hmgl00186
    • 2020-12-29
    45 min

    H4610 ki210105 Norika Kurahashi 18years old

  • amateur uncensoredh4610
    • 2021-01-16
    70 min

    FC2PPV 1646723 [Individual shooting / No / Conceived NTR 2nd round w] I came to see my fiancée with a smile during the wedding ceremony / new house search date, so I injected two seeds and returned to my fiancée w And NTRSEX Shitoruyan w

  • amateur uncensoredfc2
    • 2021-01-16
    64 min

    SIRO-4386 [First shot] [Sister who thinks of her younger brother] [Continuous climax] A gentle older sister who applied for her younger brother. If you defeat the young body of a slender beautiful girl with beautiful breasts and nice ass .. AV applic

  • amateur censoredamateursirosiro-4386siro4386siro-4386
    • 2021-01-21
    66 min

    10musume 012121_01 Fucked and Cum Inside The Girl Who Got Completely Drunk

  • amateur uncensored10musume
    • 2021-01-23
    240 min

    [REXD-349]Girls Holding It In - Tied Up On The Station Toilet... "I Can't Hold It Any Longer... I'm Going To Wet Myself..."

  • censoredcreampieamateurREXDredmanji groupREXD-349REXD349rexd00349
    • 2021-01-24
    135 min

    [DBER-097]BeAST - Wild Narcotics Investigation Squad - Case 003: The Case Of Kaori Domoto - Corrupted By S&M! No Good Thugs Strip Away This Tough Girl's Facade Hitomi Katase

  • hitomi katase censoredmature womanbdsmDBERbabyentertainmentkikubonred babeDBER-097DBER097dber00097
    • 2021-01-26
    101 min

    300MIUM-660 [Unauthorized seeding SEX] [Aspiring idol] [Ubukawa beautiful girl with a very small number of experienced people] Gachi poverty who can live with life support from friends! There is humanity from long ago, so you can get it! I want to be

  • amateur censoredamateurcosplaymiummium-660mium660300mium-660
    • 2021-01-31
    46 min

    493PKPD-087 [Leaked] Deceive the boyfriend’s JD and make a big vaginal cum shot without rubber

  • amateur censoredcreampieamateurpkpdpkpd-087pkpd087493pkpd-087
    • 2021-02-05
    73 min

    HEYZO 2485 Requesting The POV Fuck Option -Shinagawa- – Kira

  • kira uncensoredheyzo
    • 2021-02-06
    159 min

    [PRED-288]Squirting, Sweat, Saliva, Semen, And Other Secretions... Long-Haired Slut Dripping Wet With All Your Sex Juices Yuki Takeuchi

  • yuki takeuchi censoredcreampiesquirtingPREDpremiumkogoro kindaichielegancePRED-288PRED288pred00288
    • 2021-02-13
    12 min

    FC2PPV 1683951 [Amateur] Uniform sex with a fair-skinned busty female college student who was a virgin until recently [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-13
    47 min

    FC2PPV 1650498 [Limited quantity 2980pt → 1980pt] 3P massage with a single person recruited on Twitter ❤️ Libido monster enchanted by the big dick of a single person ❤️ Intruding while jealousy Many 3P purchase benefits

  • amateur uncensoredfc2
    • 2021-02-22
    130 min

    [BTIS-111]Beautiful Crossdressing Prostitute 8 - Akari

  • censoredBTISbeautiful boy publishing.companykamon seijoicross dressing sexy boyBTIS-111BTIS111btis00111
    • 2021-03-04
    60 min

    413INST-101 Reika Chan 20 years old Irresponsible seeding edition ☆ “Because I’m ♪” I’m mercilessly pistoning a sensitive pussy with an unequaled cock! Raw rape in the womb that ovulates with faint in agony acme Dopyudopyu seeding

  • amateur censoredcreampieamateurinstinst-101inst101413inst-101
    • 2021-03-13
    130 min

    [NITR-506]Sloppy Sex With Busty Stepdaughters IV Hana Himesaki

  • himesaki hana censoredbig titssingle workNITRcrystal eizonitroNITR-506NITR506nitr00506
    • 2021-04-04
    14 min

    10musume 040421_01 Secret Pussy Collection: Yuu Nagata

  • amateur uncensored10musume
    • 2021-04-15
    123 min

    [BBTU-010]You'll Swoon With Pleasure! Breast Oil Massage, Slow Titty Fuck & Slow Sex Yuria Yoshine

  • yoshine yuria censoredbig titsblowjobBBTUdogmatenunmy boyneBBTU-010BBTU010bbtu00010
    • 2021-05-07
    60 min

    SIRO-4516 [First shot] [20-year-old holiday part-time job] A cute shop clerk who usually sells adult-like clothes has appeared. Her innocent smile attracts youth, but the charm of nasty big tits is .. AV application on the net → AV experience shootin

  • amateur censoredbig titsamateursirosiro-4516siro4516siro-4516
    • 2021-05-07
    152 min

    [IPX-666]"If You've Missed The Last Train Home, Why Don't You Come Over To My Place" My Girlfriend Was Waiting For Me At Home, But After I Missed The Last Train Home, I Decided To Spend The Night At My Female Colleague's Place ...

  • minami aizawa censoredblowjobslutIPXidea pocketkahori maedanodishIPX-666IPX666ipx00666
    • 2021-05-12
    120 min

    [C-2635]Day Trip Spa Mature Woman Lust Trip #020

  • serizawa azusa censoredmature womanCgogoskoichi takahashicore gogo sC-2635C2635
    • 2021-05-14
    45 min

    FC2PPV 1798960 Vacuum blowjob with plenty of saliva ♡ Thick semen bukkake on the face of a perverted erotic wife Massive facial cumshots ♡ Main story appearance ♡ Personal shooting 73

  • amateur uncensoredfc2
    • 2021-05-22
    151 min

    [JUKF-063]Luckless College Girl Made To Pay Off Her Father's Debts - With Her Body - Kanna Kanna Misaki

  • kanna misaki censoredbig titssingle workJUKFjumpjump avJUKF-063JUKF063h-227jukf00063
    • 2021-06-06
    16 min

    10musume 060621_01 Secret Pussy Collection: Hiroko Akita

  • amateur uncensored10musume
    • 2021-06-13
    72 min

    345SIMM-646 J ○ -chan, who is beautiful and cute, is shy but obedient？ Raw vaginal cum shot in a shaved pussy that gets squeezed and gets scared! Enjoy the natural G milk plump body! !! [A special day for Kanon-chan (girlfriend) and uncle (boyfriend)

  • amateur censoredcreampiebig titssimmsimm-646simm646345simm-646
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-30
    47 min

    [063021-001][VR] Who is the best maid？ : Shaved maids who want to be master"s best favorite

  • amateur uncensoredcreampiehandjobcaribbeancom
    • 2021-07-06
    39 min

    Pacopacomama 070621_499 Showing Off Sexuality and Being Provocative! : Professional Technique Reika KudoRyoko AsamiyaRie Mukai

  • amateur uncensoredpacopacomama
    • 2021-08-04
    14 min

    Caribbeancom 080421-001 The Undisclosed: Hard Blowjob Till He Feels Numb Hitomi, Yumi Kamiya

  • amateur uncensoredcaribbeancom
    • 2021-08-17
    62 min

    SIRO-4604 [First Shot] [Climax Count Cannot Be Measured ∞] [Pleasure Absolutism] Reiwa’S Sex Beast Attacks! ？？ A Glamorous Girl Who Boasted "I Do Not Want To Do Lukewarm Sex" Goes Crazy With Full Throttle .. Application Amateur, First Av

  • amateur censoredamateursirosiro-4604siro4604siro-4604
    • 2021-09-09
    235 min

    [ABW-141]「なまめかしい」オイルまみれ3本番 河合あすな 【MGSだけのおまけ映像付き 15分】

  • amateur censoredbig titsamateurabwabw-141abw141abw-141
    • 2021-09-11
    56 min

    FC2PPV 2188931 Super Popular "Saki Hatsumi" [No] Raw Creampie Outflow 11 / Best Sex! Rookie Luxury Soap Lady Who Loves Vaginal Cum Shot On The First Day Of Entering The Store Part 2

  • amateur uncensoredfc2
    • 2021-09-25
    39 min

    FC2PPV 2248474 [7 Cum Swallow] Absolute Ace Of The Blowjob World. Have You Ever Seen Such A Beautiful Girl’S Egg Blow And Continuous Cum Swallowing？ Swallow Girls ＃ 1 Mio

  • amateur uncensoredfc2
    • 2021-09-30
    150 min

    [DIC-092]18歳と7ヶ月。 18 ミニマム145cm×美パイパン×膣奥イキ絶頂 愛野ひなた

  • amateur censoredsquirtingamateurdicdic-092dic092dic-092
    • 2021-10-14
    60 min

    285ENDX-364 Self-Proclaimed Libido Daimajin! Sensitive Unequaled Ma ○ Ko!

  • amateur censoredcreampieamateurendxendx-364endx364285endx-364
    • 2021-10-21
    93 min

    [OKB-122]Mao Watanabe: A Godly, Beautiful Lolita Bloomer With A Big Bubbly Ass. Get A Chubby Girl Into Some Gym Clothes And Take A Shot Of Her Cameltoe And Side-hair From Such A Close-up That You Can See All Her Pores! Fully-clothed Fetish Video To S

  • mao watanabe censoredschoolgirlsingle workOKBoyaji no kosatsukami bloomersOKB-122OKB1221okb00122
    • 2021-10-22
    119 min

    [JUL-750]A Popular And Slender, Exclusive Actress Her First Appearance In The Series Of Shame!! She"d Rather Die Than Fuck Him, But He Made Her Cum Like Crazy ... Ann Komatsu

  • anzu komatsu censoredmature womansingle workJULmadonnaasagiri jouJUL-750JUL750jul00750
    • 2021-10-25
    70 min

    503KOO-024 Saki (Pseudonym) (Rin Miyazaki)

  • amateur censoredschoolgirlamateurkookoo-024koo024503koo-024
    • 2021-10-29
    119 min

    [MIDE-991]Seeing My Precious Girlfriend Being Enjoyed By The DQNs In Class Using an Aphrodisiac And Made To Have Sex With You Gives Me A Poor Erection Nana Yagi

  • nana yagi censoredsingle workMIDEmoodyzshouten shiroumoodyz divaMIDE-991MIDE991mide00991
    • 2021-11-18
    487 min

    [ABBA-542]Mature Girls With Big Tits - Made To Take Womb Bukkake 30 MILFs 8 Hours 2 Discs

  • censoredcreampiebig titsABBAcenter villageABBA-542ABBA542h-086abba00542
    • 2021-12-04
    269 min

    [YMDD-255]An Amateur Observations Survey - Adorable Hono Wakamiya Will Give You A Sexy Surprise Gift!! - DVD Shop And Beach Trip Edition

  • honoka wakamiya censoredblowjobslutYMDDmomotarou eizou shuppanteam pine angelsjaku momoYMDD-255YMDD255ymdd00255
    • 2021-12-25
    138 min

    [DBER-135]Lewd Hound Club. Sacrificial Teasing. Beautiful Girl"s Cum Hell- Part 9: Sad Prey Convlused by Burning Shame And Nectar. Nana Maeno

  • nana maeno censoredschoolgirlbdsmDBERbabyentertainmentkikubonred babeDBER-135DBER135dber00135
    • 2021-12-27
    53 min

    [ETQR-328](Daydream POV) Loose Socks On This Slut. Temptation From A Beautiful Girl. SEX MIZUKI.

  • censoredcreampieuniformETQRerotic timeETQR-328ETQR328etqr00328
    • 2022-01-20
    62 min

    1Pondo 012022_001 A Woman Who Eats A Herbivorous Boy Emi Sakurai

  • amateur uncensored1pondo
    • 2022-01-27
    199 min

    [MDVHJ-047]I Can"t Tell Anyone... Who Could Have Imagined That I Was Being Fucked By My Daughter"s Husband... 6

  • natsuko haraguchi yuri mizukawa censoredbig titsmarried womanMDVHJgraffiti japanshakojimovieMDVHJ-047MDVHJ04748mdvhj00047
    • 2022-01-29
    55 min

    [292MY-532]飯島セリア 2

  • amateur censoredmarried womanamateurmymy-532my532292my-532
    • 2022-02-05
    241 min

    [YLWN-200]Can You Convince An Older At-home Massage Therapist To Have SEX With You？! 4 Hours

  • censoredamateurmature womanYLWNyellow moonpappan tateishiYLWN-200YLWN200ylwn00200
    • 2022-02-11
    22 min

    FC2PPV 2659850 [Weekend Limited Sale] Connect With The Signboard Girl Of The Popular Sexy Maid Shop In Aki 〇 Hara Via Sns And Silently Call To Your Home. Video Leaked That Enjoyed Secret Acts In Store Costumes [Prohibition Case If It Gets Caught] [ce

  • amateur uncensoredfc2
    • 2022-02-11
    119 min

    [MEYD-742]Went To A Mat Massage Parlor That Doesn"t Allow Full-on Sex, And The Stuck-up Beautiful Married Woman From Next-door Was There. I Blackmail Her Into Full-on Sex And Creampie Loads Too! She"s My Docile Sex Servant Even When She"s

  • tsukino luna censoredcreampiesingle workMEYDtameike goronaveMEYD-742MEYD742meyd00742
    • 2022-02-12
    128 min

    [KTKZ-094]The Virgin Daughter Of A Certain Celebrity. She Might Have The Face Of An Innocent Rich Girl, But Her Big-Booty Body"s As Carnal As They Come. Kasumi Nemoto (Age 20)

  • censoredamateurbeautiful girlKTKZkitixx mousouzokushinjinKTKZ-094KTKZ094ktkz00094



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored