sister big tits javcensored creampie censored




FC2WAAASDABHNDDASDAVSAAUKSRBDSHKDDASDMIDVMIAAMEYDAWDFSDSSNGODHODVVENXGVHSPRDABW

2020-09-12
146 min

[MIDE-821]I Came For The First Time! Rikka Ono

  • rokka ono censoredsquirtingblowjobMIDEmoodyztake dmoodyz divaMIDE-821MIDE821mide00821
    • 2020-09-12
    152 min

    [MIAA-312]This A-Cup Titty Girl With No Knowledge About Sex Took Me Seriously When I Started Playing With Her, And Now, When I Stimulated Her Tiny Tits, Started Spasming And Twitching With Pleasure! I Gave Her A Nipple-Tweaking Aphrodisiac Oil Massag

  • ichika matsumoto censoredbeautiful girlsingle workMIAAmoodyzrakudaeveryone s porn starMIAA-312MIAA312miaa00312
    • 2020-09-15
    65 min

    [ETQR-159][Daydream POV] Gazing At A Short Haired, Slender And Friendly Beautiful Y********l in Uniform High-Class Hotel Fucking With Aoi Nakashiro

  • nakagusuku censoredcreampieuniformETQRerotic timeETQR-159ETQR159h-1186etqr00159
    • 2020-09-19
    56 min

    FC2PPV 1507031 [Individual shooting] Cuckolding her acquaintance’s J system, taking a squirrel, while worrying about her boyfriend, she leans back with another person’s cock and lusts with a big pant voice [Appearance / Creampie]

  • amateur uncensoredfc2
    • 2020-09-20
    116 min

    [DASD-732]If I Marry Another Man Will You Give Me Your C***dren？ Yu Shinoda

  • shinoda yu censoredcreampiesingle workDASDdasjo asagiriDASD-732DASD732dasd00732
    • 2020-09-25
    240 min

    [GIGL-620]30-Something Working Married Woman's Secret Sexy Side Gig - We Scored Embarrassing Private Footage Of Married Sluts Catering To Guys With Underwear Fetishes And Sold It As Porn!

  • censoredcreampieamateurGIGLgigolo gigologigoloGIGL-620GIGL620h-860gigl00620
    • 2020-09-29
    40 min

    [oretd-766]あこ先生

  • amateur censoredcreampieamateuroretdoretd-766oretd766oretd-766
    • 2020-10-03
    119 min

    [PRED-258]A Former Local TV Announcer Is Opening Wide! A Rude And Crude Cock-Swallowing Blowjob Kano Kashii

  • kashii hanano censoredblowjobslutPREDpremiumsuisei akaielegancePRED-258PRED258pred00258
    • 2020-10-04
    239 min

    [YLWN-138]With The Bride's Mother...

  • censoredmature womanYLWNyellow moonpappan tateishiYLWN-138YLWN138ylwn00138
    • 2020-10-17
    64 min

    H0930 ki201018 Aoi Katayama 26years old

  • amateur uncensoredh0930
    • 2020-10-27
    49 min

    FC2PPV 1548794 ☆ Kurashiki series ☆ Complete appearance ☆ Serve with a phantom 19-year-old and cute maid cosplay (？) Creampie SEX ♥ [With benefits]

  • amateur uncensoredfc2
    • 2020-11-29
    266 min

    [GAV-055]The Boobs Of A Girl So Beautiful She's A National Treasure vol. 3

  • censoredcreampiebig titsGAVgogo adult videosGAV-055GAV055gav00055
    • 2020-12-10
    136 min

    [IESP-673]The Narcotics Investigation Squad Primed For Pussy Spasmic Orgasms Nana Maeno

  • nana maeno censoredcreampieschoolgirlIESPienergyusubashisuiiespIESP-673IESP6731iesp00673
    • 2020-12-26
    151 min

    [JUFE-243]A College Girl Who Is Hunting For Sugar Daddies Kanon She's Got A Beautiful, Pale Body With Big Tits And She Gets Wet And Horny For Raw Sex Breaking In Training With Dirty Old Men

  • censoredcreampiebig titsJUFEfitchJUFE-243JUFE243jufe00243
    • 2021-01-01
    303 min

    [DKSB-096]Pretty Perky S********l Booty - Hard Dildo Masturbation BEST Collection 20 Girls, 5 Hours

  • akimoto shion niimi naomi censoredschoolgirlDKSBoffice k sk s bestDKSB-096DKSB09636dksb00096
    • 2021-01-29
    46 min

    FC2PPV 1659079 [No x Creampie] ★ Naughty ★ Immerse yourself in sex while relaxing naked all the time! “selfie”

  • amateur uncensoredfc2
    • 2021-01-31
    99 min

    [VEC-464]I Took A Hot Married Woman Home From Her Part-Time Job For Creampie Sex Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-464VEC464vec00464
    • 2021-01-31
    72 min

    200GANA-2429 Seriously Nampa, first shot. 1590 Hand warmers distributed on the streets of Akiba! A beautiful legged woman on her way home from work was trapped! Erotic talk at the hotel I brought in … Gradually uplifting …

  • amateur censoredsquirtingamateurganagana-2429gana2429200gana-2429
    • 2021-02-01
    71 min

    [HKHS-010]Picking Up Girls In L.A.: Slender Body, Beautiful Legs And A Great Ass - Be Impressed By Her Wonderful Leg Techniques - Nora, 28

  • censoredcreampieamateurHKHShikara delusion grouphollywood saburoHKHS-010HKHS010hkhs00010
    • 2021-02-05
    75 min

    259LUXU-1377 Luxury TV 1362 A fascinating beauty busty bank clerk who says it was developed in the previous shoot and is easier to feel is back! Keep an eye on her too dense instinct full-blown sex that became a hedonist, exposing her glamorous body

  • amateur censoredbig titsamateurluxuluxu-1377luxu1377259luxu-1377
    • 2021-02-12
    125 min

    [IPX-611]I Give Up... Do Whatever You Want To Me - Sizzling Hot Sub Tied Up For Extreme Orgasmic Ecstasy With Relentless Fucks Anna Kami

  • anna kami censoredsquirtingsingle workIPXidea pocketdishIPX-611IPX611ipx00611
    • 2021-02-12
    182 min

    [JUFE-259]Restraint Suit Room: Beautiful Sluts Who Restrain Men And Make Them Crazy - Maria Nagai, Eri Akira

  • maria nagai aki erie arai erie yuka osawa censoredslutJUFEfitchaida yumenoJUFE-259JUFE259jufe00259
    • 2021-02-20
    101 min

    390JAC-071 [18-year-old GAL awakening x 4 vaginal cum shots] 18 years old calls 18 years old 18 years old consecutive jackpot! A new loop system advent with a new explosion gimmick on the gals! High continuation and high expectations! Everyone who ha

  • fgal censoredcreampiebig titsjacjac-071jac071390jac-071
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-27
    118 min

    [MIMK-085]Having Sex With My Super Capable Married Female Coworker On Our Business Trip! She's Always Really Serious And Scary But This Time She's Just A Woman - JULIA

  • julia censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-085MIMK085mimk00085
    • 2021-03-05
    40 min

    416SVMM-048 Nako

  • amateur censoredcreampiesquirtingsvmmsvmm-048svmm048416svmm-048
    • 2021-03-09
    139 min

    [STARS-337]School Idol Keeps On Happily Sucking Cock Even After Getting Her Face Covered In Cum! HIkari Aozora

  • hikari aozora censoredschoolgirlblowjobSTARSsod creategoemonsod starSTARS-337STARS3371stars00337
    • 2021-03-11
    264 min

    [PIYO-108]Do You Want Me To Be Your First... Ichika Matsumoto Fan Thanksgiving Day! Intimacy, Makeouts, Sweetly Breaking In Virgin Guys - We Recruited 3 Male Virgins From Social Media To Have Their First Experiences With Her!

  • ichika matsumoto censoredbeautiful girlPIYOchickclown fieldamaenboPIYO-108PIYO1081piyo00108
    • 2021-03-18
    130 min

    [RKI-607]New Bucketloads of Bukkake Eimi Fukuda

  • emi fukada censoredcreampiebig titsRKIrookieRKI-607RKI607rki00607
    • 2021-03-19
    152 min

    [SORA-302]Sex Camp Smooth And Clean Y********l Wants To Show Off Her Dirty Masochistic Side Mai Yahiro

  • mai yahiro censoredsingle workSORAyama to soratrippyySORA-302SORA302sora00302
    • 2021-03-22
    98 min

    241GAREA-501 Mizuki

  • amateur censoredbig titsamateurgareagarea-501garea501241garea-501
    • 2021-03-23
    133 min

    [KUSE-010]"I Wanna Be A Cum Dumpster" Slender, Baby-Faced Cutie Wants Men To Make Her Dirty - Buckets Of Cum Swallowing From A True Sub Servant - Inori Sasage, Age 23

  • dedication glue censoreddeepthroatsingle workKUSEsod createevening editionthis actress style is amazingKUSE-010KUSE0101kuse00010
    • 2021-03-25
    121 min

    [RCTD-391]Dirty Talking Female Anchor, 25 Years Old: A Female Announcer With Crazy Habits SP - Sei Maihara

  • kiyoshi maihara censoredbig titssingle workRCTDrockettaro kanbeRCTD-391RCTD3911rctd00391
    • 2021-03-26
    240 min

    [OKAX-717]If You Get An Old Lady To Your Room, She's Down To Fuck 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-717OKAX71784okax00717
    • 2021-04-05
    35 min

    FC2PPV 1755831 Up to 12 1480 [No] ＃ Slender and big breasts saffle. It goes out of control in her vagina.

  • amateur uncensoredfc2
    • 2021-05-16
    128 min

    [MXGS-1185]Lovey Dovey Sex With Huge F***eful K-Cup Tits Bouncing Here And There Yua Makura

  • yu asakura censoredcreampiebig titsMXGSmaxingMXGS-1185MXGS1185h-068mxgs01185
    • 2021-05-20
    152 min

    [FSDSS-232]Amateur Real Life College Girl Is Interested In The World Of Porn Rin Natsuki Porn Debut

  • rin natsuki censoredbig titsbeautiful girlFSDSSfalenosatoshi maedafaleno starFSDSS-232FSDSS2321fsdss00232
    • 2021-05-28
    71 min

    FC2PPV 1840783 "Most of the time! Ku * e-kun!" Part2. Beautiful legs-san de Pikone Naka ○ Shibe Ku □ Echiechi Hen 2 [Personal shooting]

  • amateur uncensoredfc2
    • 2021-06-04
    52 min

    SIRO-4538 [First shot] [Soaked teacher] A slender cram school teacher who teaches mathematics to junior high school students has appeared. Innocent girlfriend also fascinates a woman’s face when a naughty atmosphere spreads .. Application amateu

  • amateur censoredamateursirosiro-4538siro4538siro-4538
    • 2021-06-10
    122 min

    [FSDSS-239]A Young Wife Who Was Developed And Immediately Transformed Into A Cumming Sex Toy By Her Perverted Father-in-law - Moe Tenshi

  • angel moe censoredsquirtingblowjobFSDSSfalenowild sevenfaleno starFSDSS-239FSDSS2391fsdss00239
    • 2021-06-12
    265 min

    [XRLE-005]A Woman Who Loves To Suck Cock - Lennon Kanae

  • kanae lenno censoredblowjobslutXRLEreal worksannie nakamurareal real worksXRLE-005XRLE005xrle00005
    • 2021-06-18
    89 min

    [MBDD-2056]Haruka Morimoto/Secret Love

  • haruka morimoto censoredbeautiful girlsingle workMBDDmedia brandMBDD-2056MBDD2056301mbdd02056
    • 2021-06-19
    59 min

    SIRO-4512 AV application on the net → AV experience shooting 1566 [First shot] [Former idol] [Geki Kawa signboard girl] The former idol who fascinates the beauty style in front of the camera has an obscene expression that fans have never seen Floatin

  • amateur censoredamateurbeautiful girlsirosiro-4512siro4512siro-4512
    • 2021-06-24
    139 min

    [IESP-682]S********l Rin Miyazaki Takes 20 Loads in a Row Creampie

  • miyazaki rin censoredcreampieschoolgirlIESPie nergykiku riniespIESP-682IESP6821iesp00682
    • 2021-06-25
    30 min

    359TYVM-167 Saliva Exchange With Tongue Tangled Rich Berokisu Creampie Sexual Intercourse! !!

  • amateur censoredcreampiemarried womantyvmtyvm-167tyvm167359tyvm-167
    • 2021-07-15
    51 min

    481SACZ-049 Hitomi 1

  • amateur censoredamateurbdsmsaczsacz-049sacz049481sacz-049
    • 2021-07-17
    120 min

    [JUL-650]Kana Yume 10th Anniversary!! First Time with a Co-Star & First Lesbian Sex!! Alumni Reunion After 10 Years Lesbian Sex with a Long-Loved Former S*****t...

  • kana yui hojo asahi censoredlesbianmature womanJULmadonnamametaro mamezawaJUL-650JUL650jul00650
    • 2021-07-23
    117 min

    [MRSS-117]"Next Year, Let's Cum Back Here And Go Picking For Grapes Again, Okay ...？" In Order To Earn The Money To Pay For Our Son's Surgery, My Beloved Wife Signed A Contract To Become A Cum Bucket For A Rich Man For One Year. Honok

  • tsujii honoka censoredcreampiebig titsMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-117MRSS117mrss00117
    • 2021-07-23
    107 min

    [SQTE-379]This Girl Is Amazing! G-Cup Big Titty Girl Bursts With Sweat And Sex Juices Rua Takashiki

  • takashiki censoredbig titssquirtingSQTEs cuteSQTE-379SQTE379sqte00379
    • 2021-07-30
    135 min

    [JUL-665]Cuckold Video Of Camping In Town: A Video Of A Wife Shockingly Cuckolded And Given Repeated Creampies - Megu

  • mio meg censoredcreampiemature womanJULmadonnatomitake taroJUL-665JUL665jul00665
    • 2021-07-30
    119 min

    [SSIS-133]Although We Joined The Company The Same Year, I Become A Kissing Demon When I Have A Few Sips: Do You Dislike Me？ miru.

  • miru censoredbeautiful girlslutSSISs1 no 1 styleasagiri jouSSIS-133SSIS133ssis00133
    • 2021-08-14
    43 min

    404DHT-0300 Curious About Anal Harenchi Big Ass Wife Akemi 42 Years Old

  • amateur censoredcreampiemarried womandhtdht-0300dht0300404dht-0300
    • 2021-08-28
    186 min

    [JKSR-505]One Night Stand With A Country Wife - Married Woman Slurps Liquor And Semen In Shinjuku - Rural Wives Only - Picking Up Married Sluts Looking To Cheat At A Bus Terminal 14

  • censoredamateurJKSRbigmorkalobockeypinkjunkyJKSR-505JKSR50557jksr00505
    • 2021-09-17
    120 min

    [PRED-339]"Even If We Commit Infidelity, No One Will Ever Find Out, Right ...？" I Was Posted To This City, Away From My Family, And To My Surprise, I Discovered That My Neighbor Was A Colleague From Work. Minami Hatsukawa

  • hatsukawa minami censoredcreampieslutPREDpremiumtorendei yamaguchielegancePRED-339PRED339pred00339
    • 2021-09-18
    118 min

    [HALE-008](Riko & Arisa) Following 2 Girls On Social Media For Panty Shot Dancing That Leads To A Pleasure Filled Threesome With Hot "Ahegao" Ecstasy-filled Expressions

  • censoredcreampieuniformHALEhalentino mousouzokuhalentinomamatomo kui mugen loopHALE-008HALE008hale00008
    • 2021-09-24
    86 min

    529STCV-018 Natsu (Natsu Tojo)

  • amateur censoredcreampieamateurstcvstcv-018stcv018529stcv-018



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored