slut javcensored censored chubby high vision




FC2ADNIPXLULUHZGDHODVHUNTBSDABJULWAAADASDMILKGVHAVSAMIDEAWDSQTEPPPDAUKSBBANMARA

2020-11-01
58 min

324SRTD-0195 As a result of the store installing a hidden camera for a fact-finding survey of customers seeking actual acts prohibited by luxury esthetics

  • amateur censoredcreampieamateursrtdsrtd-0195srtd0195324srtd-0195
    • 2020-11-07
    241 min

    [MMMB-034]A Filthy Odor Permeates This Lesbian Clinic 4 Hours

  • censoredcreampiebig titsMMMBmellow moonpig momMMMB-034MMMB034mmmb00034
    • 2020-11-10
    31 min

    FC2PPV 1565360 [First time until November 19th 1700pt → 1200pt] [First shot] Gonzo with a half-faced 28-year-old wife! !! I’m frustrated and just masturbate … [High quality]

  • amateur uncensoredfc2
    • 2020-12-18
    109 min

    [DDFF-005]Oral Interview - Deep Throat Discussion Ayaka Mochizuki

  • ayaka mochizuki censoreddeepthroatsingle workDDFFdogmafk 2DDFF-005DDFF005ddff00005
    • 2020-12-31
    240 min

    [DVDMS-616]Ordinary Guys And Girls Caught On Camera - Amateur College Couples Separated By A One-Way Mirror Try To Resist Porn Stars' Incredible Sex Techniques! Amateur College Guys (Boyfriends) VS The Actress The Men Of The World Have Fallen In

  • yui hatano censoredcreampieamateurDVDMSdeep sfunky hasegawaDVDMS-616DVDMS616dvdms00616
    • 2021-01-08
    128 min

    [DIC-081]The Miracle Of Hyogo! Beauty Parlor Babe With Limitless Lust Ran Kusunoki Makes Her Porn Debut - Edged To The Limit Of Her Senses - Her First Multiple Orgasms!

  • kusunoki orchid censoredsquirtingblowjobDICprestigetsuruhashidiscoverDIC-081DIC081118dic00081
    • 2021-01-22
    244 min

    [MGT-133]Amateur Perversion Revolution vol. 04

  • censoredcreampiebig titsMGTprestigemegatraMGT-133MGT133118mgt00133
    • 2021-01-30
    61 min

    Caribbeancom 013021-001 Special Boobs SEX For Boobs Fetish Airi Mikumo

  • airi mikumo uncensoredcreampiehandjobcaribbeancom
    • 2021-02-16
    34 min

    495MOJ-009 Ichika

  • amateur censoredamateurbeautiful girlmojmoj-009moj009495moj-009
    • 2021-02-19
    142 min

    [KTB-040]The Carnal Office Girl Club 7 - Dispatched From The Office To Satisfy Your Sexual Urges, Miss Misono Will Milk Your Seed - Misono Waka

  • misono waka censoredbig titssingle workKTBkahanshin tigers mousouzokukahanshin tigersKTB-040KTB040ktb00040
    • 2021-02-20
    62 min

    [WKD-039]A Video Sex Record Of Adultery, Committed During A Married Woman Secret Meeting Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiebig titsWKDwaap entertainmentk westwWKD-039WKD0392wkd00039
    • 2021-02-25
    209 min

    [SW-758]My Little Stepsister And Her Friends Are Devilish Little Ass-Shaking Sluts! This Big Stepbrother And Stepfather Fell For Their Miniskirt Panty Shot Temptation. And Now, They're Enjoying The Nervous Thrills Of Fucking Behind Their Little S

  • censoredSWswitchyocchanswitch switchSW-758SW7581sw00758
    • 2021-03-02
    64 min

    Caribbeancom 030221-001 The Continent Full Of Hot Girls, File.082 Kisumi Inori

  • kisumi inori uncensoredcreampiecaribbeancom
    • 2021-03-05
    130 min

    [HODV-21555]Sensual Sex Licking Every Last Inch Of Your Body Natsu Tojo

  • natsu tojo censoredsingle workHODVh m pk c takedaHODV-21555HODV215555642hodv21555
    • 2021-03-07
    43 min

    490FANY-24 Karin 4

  • amateur censoredamateurfanyfany-24fany24490fany-24
    • 2021-03-11
    123 min

    [GS-378]Back-Arching Aphrodisiac Oil Massage Parlor Newly Opened Oil Massage Parlor For S********ls Who Want To Feel Like Women!

  • censoredGSsosoru x garconred ballGS-378GS3781gs00378
    • 2021-03-11
    53 min

    435MFC-088 [Teenage God Amateur] 3rd round with a female college student who is Ubu but has strong libido and the highest sensitivity ♪ All-you-can-eat all-you-can-eat nurses in erotic cami! Conceived festival of all vaginal cum shot! !! [Shiroto Gon

  • amateur censoredcreampieamateurmfcmfc-088mfc088435mfc-088
    • 2021-03-25
    12 min

    FC2PPV 1740261 Until 27 [Uncensored] A fair-skinned simple girl who came to Tokyo. Staying continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-03-26
    150 min

    [MIDE-902]Girl Who Gives Vacuum Blowjobs Gets Deep Throated And Cum Shot On Her Face! Shoko Takahashi

  • shoko takahashi censoredbig titsblowjobMIDEmoodyzmoodyz divaMIDE-902MIDE902mide00902
    • 2021-03-31
    545 min

    [LXV-016]【期間限定販売】【MGSだけのおまけ映像付き 65分】ラグジュTV×PRESTIGE PREMIUM 14 オトナのエロさここに極まる！美女達の本当の姿を余すところなく全部見せます！！

  • amateur censoredbig titsmarried womanlxvlxv-016lxv016lxv-016
    • 2021-04-15
    180 min

    [DIPO-091]Hung Older Guy Secretly Films His Fucks With A Married Slut - Lost In Creampie Sex

  • censoredDIPOprimoero nandesuDIPO-091DIPO091h-283dipo00091
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-06
    98 min

    [HONE-260]Soft Pressure And Squishy Squeezing! Groping My Step Mom's Titties Mako Oda

  • oda mako censoredcreampiebig titsHONEcenter villagesouthern earthhanazono center villageHONE-260HONE260h-086hone00260
    • 2021-05-10
    116 min

    [TENV-19037]Transsexual Monika & Andrea

  • censoredslutTENVtennin xTENV-19037TENV19037h-1542tenv19037
    • 2021-05-26
    49 min

    481SACZ-033 Yuko 5

  • amateur censoredmarried womanamateursaczsacz-033sacz033481sacz-033
    • 2021-06-30
    59 min

    444KING-040 Miharu

  • amateur censoredcreampiebig titskingking-040king040444king-040
    • 2021-07-01
    241 min

    [CUBEX-002]Absolutely Nut-Busting Raw Fuck Collection 2 - Picking Up Hot Busty Office Girl Amateurs On Vacation 4 Hours

  • censoredcreampiebig titsCUBEXcubeCUBEX-002CUBEX002h-1593cubex00002
    • 2021-07-19
    67 min

    498DDH-023 Alafor Big Tits Wife Plays With Fire For The First Time In The 12th Year Of Marriage! A Younger Colleague Persuaded Me To Get A Thrilling Blow Job In A Company Car → Public Masturbation Brought To The Hotel! Shake The Ripe Body And Squirt

  • amateur censoredbig titsmarried womanddhddh-023ddh023498ddh-023
    • 2021-08-14
    43 min

    404DHT-0094 An Unabated E-Cup Past The Fifty! Yuri 55 Years Old

  • amateur censoredbig titsamateurdhtdht-0094dht0094404dht-0094
    • 2021-08-25
    65 min

    Caribbeancom 082521-001 The Undisclosed: Various Types! Blow Job Of Your Choice Hasumi Yoshioka, Mitsuki Harutori, Kotomi Yamazaki

  • amateur uncensoredhandjobbukkakecaribbeancom
    • 2021-08-26
    164 min

    [NHDTB-568]A Slut In A Beer Garden By The Sea

  • censoredNHDTBnatural highjaken kodamaNHDTB-568NHDTB5681nhdtb00568
    • 2021-09-10
    122 min

    [UMD-795]Big Tits Girls In Working Clothes Have Bursting Tits That Are So Much Bigger Than Normal It"s Intolerable!!

  • inaba yoshine yuria censoredbig titsnurseUMDleodragon nishikawaUMD-795UMD795125umd00795
    • 2021-10-06
    79 min

    435MFC-147 [Dotapun National Treasure H Cup Body] No Explanation Required! !! !! The Big God Milk Is Coming! Squirting Fucks With A Hard Piston To A Minor Who Has Outstanding Sensitivity And Does Not Stop Squirting! !! Ona Ban 1 Month’s Worth Of

  • amateur censoredcreampiebig titsmfcmfc-147mfc147435mfc-147
    • 2021-10-06
    56 min

    541AKYB-008 Maki (23) Innocent School ♪ (Moe Osawa)

  • amateur censoredamateurakybakyb-008akyb008541akyb-008
    • 2021-10-08
    229 min

    [TSP-447]Women Who Were Targeted By Perverts! Stun Gun Shame I"ll Suck On Your Cameltoe For You ...

  • censoredcreampieTSPtoukyou supesharugroupTSP-447TSP447tsp00447
    • 2021-10-15
    61 min

    Caribbeancom 101521-001 Debut Vol.70: Deep Sex With A Pure Hearted Girl Hina Hodaka

  • hina hodaka uncensoredcreampiecaribbeancom
    • 2021-10-22
    159 min

    [SSIS-193]This Voluptuous Elder Sister Type Works At A Soapland And She"s Super Skilled At Giving Incredibly Soft Titty Fuck Action And Enveloping Your Cock With Her Luscious Boobies Konan Koyoi

  • koyoi konan censoredbig titsslutSSISs1 no 1 stylezampaSSIS-193SSIS193ssis00193
    • 2021-10-28
    111 min

    [SPRD-1475]I Like My Old, Decrepit Ex-Wife Better Than My Younger, New Wife ... Hitomi Misono

  • hitomi misono censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1475SPRD147518sprd01475
    • 2021-11-01
    71 min

    345SIMM-673 [NTR] A Trap Set Up By A Metamorphosis Husband … A Close-Up Nude Shoot Of A Beautiful Wife And A Young Male Model. My Wife Is A Wife And She Releases Love Juice While Being Watched By Her Husband … This Couple, The Best Matching

  • amateur censoredmarried womanamateursimmsimm-673simm673345simm-673
    • 2021-11-01
    33 min

    FC2PPV 2394313 Appearance! !! Limited Number [Uncensored] Cuteness, Sexyness, Lewdness … Creampie In A Fair-Skinned Gcup Beauty With A Beautiful Look !! (Part 2)

  • amateur uncensoredfc2
    • 2021-11-05
    172 min

    [BBAN-348]Want to Wear You Out At Night Then Make Love Again As Sun Rises. Shihori Kotoi. Lesbian Release. Kana Morisawa

  • shiori kotoi kana morisawa kanako iioka censoredlesbianBBANbibianBBAN-348BBAN348bban00348
    • 2021-11-06
    50 min

    FC2PPV 2407246 * Until 11/7 2980 ⇒ 1980 ★ ☆ Beauty ♥ Tightened Slender Body ♥ Beautiful Yoga Instructor Reika 27 Years Old ☆ Cool Look ♥ Bicubic Faint In Agony Man Juice Dripping Raw Squirrel Cum Shot ♥ ※ There Is A Privilege

  • amateur uncensoredfc2
    • 2021-11-19
    89 min

    AVKH-205 Ayaka (Ayaka Muto)

  • amateur censoredcreampieamateuravkhavkh-205avkh205avkh-205
    • 2021-11-21
    60 min

    [112121-001]SEX while exchanging saliva!

  • erika shiomi uncensoredcreampiehandjobcaribbeancom
    • 2021-12-17
    165 min

    [DVDMS-752]A Normal Boys And Girls Focus Group Adult Video This Taiwanese College Girl With A Big Ass Came To Japan To Tour The Country, And Came To My Room To Rent My Place Out For The Night, And Right Until The Day She Went Home, She Fucked Me In T

  • censoredcreampieamateurDVDMSdeep sswing nagaseDVDMS-752DVDMS752dvdms00752
    • 2021-12-19
    71 min

    383REIW-101 Yui

  • amateur censoredcreampieamateurreiwreiw-101reiw101383reiw-101
    • 2021-12-24
    146 min

    [JUL-803]Cute, Beautiful, Sexy. A Married Woman With Many Faces, Yukari Shizuki, 29, AV DEBUT

  • shizuki yukari censoredmature womansingle workJULmadonnamametaro mamezawaJUL-803JUL803jul00803
    • 2022-01-14
    123 min

    [FOCS-043]A Certain Major App Gets A Surge Of Bookings When A Rental Girlfriend Is Featured! "This Is Actually Bad..." From Recently Matured Guys To Sadistic Guys, They All Wish For Their Ideal Girlfriend With This Super Lewd App. Mai Kagari

  • flower hunting censoredbeautiful girlsingle workFOCSabc mousouzokufocusFOCS-043FOCS043focs00043
    • 2022-01-14
    153 min

    [MIAA-562]If You Have Money, You Can Do It! Girls With Big Tits Buying Large Amounts Of Creampie. Kokona Asakura. Kasumi Tsukino.

  • kasumi tsukino asakura here censoredcreampiebig titsMIAAmoodyzryo gokuminna no kikatanMIAA-562MIAA562miaa00562
    • 2022-01-22
    300 min

    [BDSR-471]Do You Like Beautiful Anal？ 10 Beautiful Married Woman Climaxing Through Their Asses - 5 Hours

  • censoredanalBDSRbig morkaltakeda banderasBDSR-471BDSR47157bdsr00471
    • 2022-01-28
    239 min

    [IBW-856]Shaved & Tanned Hot Cowgirl Video Collection - 4 Hours

  • amateur censoredIBWi b worksIBW-856IBW856
    • 2022-02-12
    88 min

    [HOKS-114]Record Of Crazy Family"s Fuckfest! Winter Fakecest

  • natsuna sasaki tamaki walnut censoredbig titsmature womanHOKSfa prokinzo ogurokkuHOKS-114HOKS114hoks00114
    • 2022-03-04
    52 min

    564BMYB-011 Amateur Big Tits Kaori Kaori

  • amateur censoredcreampiebig titsbmybbmyb-011bmyb011564bmyb-011
    • 2022-03-05
    153 min

    [DGCEMD-141]Available Exclusively! Bonus Footage Included! Scream! Faint In Pleasure! G-Spot Build-up! She Gets Pleasured So Deep In Her Pussy 2. Megu Mio

  • mio meg censoredmature womanDGCEMDcelebrity friendsDGCEMD-141DGCEMD141dgcemd00141
    • 2022-03-08
    80 min

    [FGMT-012]Meeting A College Girl With A Secret Online Name Who Sends Dirty Messages For a Naughty Photo Session/Nana Matsuzaka.

  • amateur censoredFGMTorustak softFGMT-012FGMT012
    • 2022-03-19
    27 min

    FC2PPV 2735794 [Permanent Preservation Version] Mizuki-San, Who Has The Sex Appeal Of That Child And An Adult Of A National Beautiful Girl ❤️ Two Crazy Oma ○ Ko ❤️ Massive Cum Release To A Young Body Review Privilege Is High Quality Zip

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored