some chan




FC2ADNMILKRBDSPRDMARASTARSSHKDHZGDABWDASDSQTECAWDSSISAVSAVEMAAWDKSBJJUFEGMEMMIDE

2021-01-16
33 min

FC2PPV 1641101 [Personal shooting] Kana 20-year-old shaved beauty! It is a vaginal cum shot to an elegant neat and sexy beauty who can not be thought of as 20 years old!

  • amateur uncensoredfc2
    • 2021-01-19
    29 min

    FC2PPV 1651181 The 3rd edition of Mai-chan, a beautiful girl! Last before holidays! The long-awaited cosplay work! Blow and bounce from without a blow job and cum inside! The last is a surprising flood squirting!

  • amateur uncensoredfc2
    • 2021-01-21
    94 min

    [REBD-527]Rin Oriental Exotic Girl - Rin Miyazaki

  • miyazaki rin censoredsingle workREBDrebeccakawaREBD-527REBD527h-346rebd00527
    • 2021-01-23
    120 min

    [DASD-804]Cheeky Transsexual Enjoys Watching Guys Struggle To Hide Their Excitement In Public Bath House - Sara Aizawa

  • aizawa sara censoredsingle workDASDdascognac kaminoDASD-804DASD804dasd00804
    • 2021-01-24
    44 min

    FC2PPV 1657905 [10 months pregnant] It was the best ever. Amateur Beauty Big Breasts Pregnant Woman First 3P Creampie Orgy Gonzo SEX Continuous Creampie “I’m Pregnant But I Will Make A Child!” W (Θ Θ) w Hah!

  • amateur uncensoredfc2
    • 2021-01-27
    79 min

    259LUXU-1373 Luxury TV 1358 [Natural busty sister is coming again! ] I want to see the overwhelming big tits that sway and dance with each piston forever! I’m thrilled by the gestures that sway the man’s heart …! Because of the greedy

  • amateur censoredbig titsamateurluxuluxu-1373luxu1373259luxu-1373
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    48 min

    FC2PPV 1680900 [Uncensored] I made a part-time job at a convenience store picked up ♥ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-12
    240 min

    [MGT-134]Picking Up Girls On The Street! Vol. 100 - Real College Girl Amateur Pickups. 17

  • censoredcreampieamateurMGTprestigemegatraMGT-134MGT134118mgt00134
    • 2021-02-19
    65 min

    SIRO-4435 [First shot] [Fair-skinned female college student] [For intense pursuit ..] JD 20 years old who has experience only with boys of the same age. The cutest girl in the circle is at the mercy of adult techniques .. AV application on the net →

  • amateur censoredsquirtingamateursirosiro-4435siro4435siro-4435
    • 2021-03-01
    120 min

    [EMOT-015]Newlywed Life With Rin Kira To Enjoy In Full POV

  • kira rin censoredcreampiesingle workEMOTplanetdirector oemotionEMOT-015EMOT015h-237emot00015
    • 2021-03-06
    56 min

    H4610 tk0030 Misato Kushimoto 21years old

  • amateur uncensoredh4610
    • 2021-03-13
    40 min

    FC2PPV 1725183 [Individual shooting] Erotic back dirt J system of small breasts inverted nipple and raw Paco Enko! I was very excited about the sensitive bicubic reaction [Creampie / Creampie]

  • amateur uncensoredfc2
    • 2021-03-18
    120 min

    [SSIS-017]You Woke Up After A Wild Party With The Hot J-Cup Boss You've Always Wanted. The Two Of You Have Your Own Afterparty - Naked - Together Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 stylerokusaburo mishimaSSIS-017SSIS017ssis00017
    • 2021-03-27
    120 min

    [KSBJ-128]My Step Mom Loves Playing WIth Me Matsuri Kanan

  • nichinan festival censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-128KSBJ128ksbj00128
    • 2021-03-30
    129 min

    [STARS-358]"Why Don't You Bring Your Work Back To My Place？" My Coworker Was So Bangin' Hot In No Panties, No Bra, And No Makeup That We French Kissed And Fucked Until The First Train. Makoto Toda

  • makoto toda censoredcreampiebeautiful girlSTARSsod createbungo maedasod starSTARS-358STARS3581stars00358
    • 2021-04-05
    241 min

    [BUR-568]The Best Little Bumps Best Of Y********ls With Small Tits 4 Hours

  • censoredcreampiebeautiful girlBURglay zburst graceBUR-568BUR56812bur00568
    • 2021-04-16
    80 min

    FC2PPV 1773451 Active teenager. She has a transparent uniform and a lot of facial cumshots on a fair-skinned beautiful girl with a baby face.

  • amateur uncensoredfc2
    • 2021-04-18
    145 min

    [KSAT-037]Naughty Older Man Nails A Busty Married Slut And Films It Miu, Age 25

  • censoredcreampiebig titsKSATstrong woman s table daydream tribetable of a strong womanKSAT-037KSAT037ksat00037
    • 2021-05-01
    153 min

    [JUL-556]Beauty Among Beauties: Fresh Face Megu Mio Makes Her Porn Debut At Age 26! Rated Number 1 Prettiest Married Woman In The Akita, The Prefecture Ranked Number 1 In All Of Japan For Hot Babes

  • mio meg censoredmature womansingle workJULmadonnamametaro mamezawaJUL-556JUL556jul00556
    • 2021-05-13
    60 min

    336KNB-154 AV Appearance In Just 3 Months Of Marriage! Reason for appearance "Oh, I don’t have enough chin …" A spear man married woman has appeared! While being inserted, I want to continue to play with my clitoris and do whatever

  • amateur censoredmarried womanamateurknbknb-154knb154336knb-154
    • 2021-05-14
    125 min

    [ARM-978]Raunchy S********ls Masturbate While Showing Off Their Stained Wet Panties

  • otohana eve hazuki peach censoredschoolgirlARMaroma planningmania satoshiaromaARM-978ARM978arm00978
    • 2021-05-22
    279 min

    [NSPS-997]She Looks Meek But You Won't Believe How Crazy Her O-Face Looks! Hotaru Mori BEST

  • hotaru mori censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-997NSPS997nsps00997
    • 2021-05-28
    56 min

    FC2PPV 1841342 * Monthly limited 2980⇒1980pt ★ First shot ☆ Rainy day married woman! A beautiful mom with a child gets a vaginal cum shot with another stick ♥ Sakura’s 23 years old ☆ Electric Maiki ♥ Intense cancer thrusting bicubic faint in ago

  • amateur uncensoredfc2
    • 2021-06-08
    140 min

    [MSFH-061]Hot Babe So Desperate For Your Seed She Spreads Her Own Pussy Wide For Your Creampie Konomi Yoshinaga

  • konomi yoshinaga censoredcreampiesingle workMSFHsod createzaku araims sodMSFH-061MSFH0611msfh00061
    • 2021-06-10
    195 min

    [ABW-101]働く痴女系お姉さん vol.15 働く蜜美杏の5シチュエーション 蜜美杏 【MGSだけのおまけ映像付き 15分】

  • amateur censoredbig titssquirtingabwabw-101abw101abw-101
    • 2021-06-23
    59 min

    Caribbeancom 062321-001 Debut Vol.68 : Continuous vaginal cum shot to the first take off former gravure idol with a smile Asami Ishida

  • asami ishida uncensoredcreampiecaribbeancom
    • 2021-06-24
    100 min

    [RCTD-407]High S*********ls Spread Their Legs And Do Weird Ass Play

  • aino rei sena asami miko shion censoredanalschoolgirlRCTDrocketroot yamazakiRCTD-407RCTD4071rctd00407
    • 2021-07-12
    69 min

    IDJS-057 Aya

  • amateur censoredcreampieamateuridjsidjs-057idjs057idjs-057
    • 2021-07-19
    20 min

    Caribbeancom 071921-001 Pussy Encyclopedia : Nana Nanami

  • nana nanami uncensoredcaribbeancom
    • 2021-07-22
    119 min

    [WAAA-085]The Tight Cowgirl Sex Is So Good She Comes Multiple Times True Loving Creampie Bathhouse Nanase Asahina

  • asahina nanase censoredcreampiesingle workWAAAwanz factorywanzWAAA-085WAAA085waaa00085
    • 2021-07-23
    61 min

    328HMDN-385 [I’M Going With A Nipple! ] Health-Loving Married Woman 26 Years Old Milk To Be Stretched At The End Of Breastfeeding! Free Massage Pick-Up On Sns For Married Women Suffering From Stiff Shoulders. Pretending To Be A Treatment, The Ap

  • amateur censoredcreampiebig titshmdnhmdn-385hmdn385328hmdn-385
    • 2021-08-03
    58 min

    499NDH-026 [Urgent Coverage] Affair Creampie Sex In Exchange For Rewards! Married Woman Who Has Become Sexless With Her Husband Who Is Gambling Addiction [Translation Ali Debt Wife Case 2]

  • amateur censoredcreampiemarried womanndhndh-026ndh026499ndh-026
    • 2021-08-05
    120 min

    [LOL-197]Mouth Specialist, "I Was Fucked By My Stepbrother"s Friends... I Can"t Believe I Would Be Fucked By My Stepbrother..." The Cutest Younger Sister - Urara Kaon

  • hanaoto urara censoredcreampieuniformLOLglayzrori senkaLOL-197LOL19712lol00197
    • 2021-08-12
    158 min

    [SVDVD-872]My Big Stepsister Is A Reggae Dancer Who Likes To Shake Her Big Ass, And Then With Her Friend, Who Also Has A Great Big Ass, They Like To Take Things Even Further By Doing A Double Grind Cowgirl On Me And Showing Off Their Assholes And Dra

  • hamazaki mao yuuki akagi censoredcreampiedramaSVDVDsadistic villageonipanSVDVD-872SVDVD8721svdvd00872
    • 2021-08-13
    123 min

    [FOCS-012]Let"s Do It In A Swimsuit! Fun Sex With A Big Tits Bitch In The Hotel"s Pools Who Lives For Fun. Kaho Imai

  • natsuho imai censoredbig titsbeautiful girlFOCSabc mousou zokufocusFOCS-012FOCS012focs00012
    • 2021-09-01
    82 min

    FC2PPV 2118991 [Personal Shooting] F Cup 18-Year-Old Professional Student Living In Shizuoka Prefecture Sex & Handjob Bukkake For A Total Of 2 Hours Recording For Money

  • amateur uncensoredfc2
    • 2021-09-10
    155 min

    [SSIS-170]Hot Therapist Who Loves To See Men"s O-Faces (In-Ear Whispering, Nipple Play, Cock Teasing, Ball Massage, Anal Rimjob) Experience All 5 Of Her Best Erotic Techniques For 12 Intense Loads Shion Yumi

  • evening beauty censoredbig titshandjobSSISs1 no 1 stylegoemonSSIS-170SSIS170ssis00170
    • 2021-09-16
    21 min

    HEYZO 2610 A Titty Fuck with Kokoro – Kokoro

  • kokoro uncensoredblowjobcumshotheyzo
    • 2021-09-17
    120 min

    [PRED-337]Training Camp NTR Cheating Scenario (Exclusive Actress Special!) College Girlfriend Hooks Up With A Player For Infidelity And Creampie Footage. Ai Hoshina

  • sena ai censoredcreampieblowjobPREDpremiummorutsu kunelegancePRED-337PRED337pred00337
    • 2021-09-23
    159 min

    [IENF-166]Naive Girl From A Private Girls" School Is Ready To Try!？ One Sheet Of Plastic Wrap Is All That Separates Her From Trying Her Guy Friend"s Dick!

  • miu ito yumi kikuchi censoredcreampieschoolgirlIENFie nergyienfIENF-166IENF1661ienf00166
    • 2021-09-30
    61 min

    326GCP-011 Slutty Amateur 100! Have A Cute Face! !! Beautiful Girl Slut Playing With A Man With An Innocent Smile! !! (Erina Oka)

  • amateur censoredamateurbeautiful girlgcpgcp-011gcp011326gcp-011
    • 2021-10-08
    116 min

    [VEMA-170]美人女教師の彼女はクラスの担任で部活の顧問でボクの恋人 羽咲美亜

  • mia hasaki censoredcreampiebig titsVEMAvenustamatsuka bingomegami venusVEMA-170VEMA170vema00170
    • 2021-10-12
    64 min

    200GANA-2569 In The Spear Room Of The Nampa Master Of 100 Battles, Bring In Sex Hidden Shooting 221 Contrary To The Appearance Of A Gal, A Fishing Girl Who Is A Sea Fishing Daisuki! Perhaps Because I’m Usually Surrounded By My Uncle, When I Call

  • amateur censoredbig titsamateurganagana-2569gana2569200gana-2569
    • 2021-10-15
    117 min

    [PPPD-964]The Rabbit I Helped Came To Pay Me Back! Hitomi, A Bunny With Colossal Tits

  • hitomi censoredcreampiebig titsPPPDoppaiPPPD-964PPPD964pppd00964
    • 2021-11-05
    78 min

    300NTK-655 [Beautiful Big Breasts Echona JD Geki Iki] [Beautiful Girl’S Gachi Nursing Service Blow Explosion] [Jijii Ko Cowgirl Continuous Creampie] Job Hunting JD Duo Who Will Give 3P To The End Of The Dirty Little Erotic Old Man! !! Erotic Cur

  • gjdsexnn censoredcreampiebig titsntkntk-655ntk655300ntk-655
    • 2021-11-05
    340 min

    [HUNTB-131]Big Tits Solo Campaign To Get These Girls Fucking All In A Row! The Amount Of Endless Fucking In This AV Just Might Reach A New Level! Taking Turns For Crazed Horny Fun!

  • censoredcreampiebig titsHUNTBhunterborubo nakanohhh groupHUNTB-131HUNTB131huntb00131
    • 2021-11-06
    60 min

    10musume 110621_01 G Cup Net Dress Girl Who Cums Many Times Nami Minami

  • amateur uncensored10musume
    • 2021-11-08
    89 min

    [ETQR-308][Daydream POV] We Will Send You a Vulgar Slut of a Married Woman. 25 Years Old, Married for Two Years. Nanami (Pseudonym)

  • censoredcreampiemarried womanETQRerotic timeETQR-308ETQR308etqr00308
    • 2021-11-12
    88 min

    380SQB-127 Nene (First Love Nene)

  • amateur censoredcreampiebig titssqbsqb-127sqb127380sqb-127
    • 2021-11-23
    54 min

    498DDH-047 A Close-Fitting Massage That Invites An Erection By Making Full Use Of A Beautiful Body. (Mizuki Yayoi)

  • amateur censoredcreampiebig titsddhddh-047ddh047498ddh-047
    • 2021-12-04
    120 min

    [AUKG-528]Lesbian Stalker. I Was Targeted By A Little Devil Girl In Uniform. Aoi Mizutani, Tsugumi Misuzawa

  • aoi mizutani tsugumi mizusawa censoreduniformlesbianAUKGu krentoAUKG-528AUKG528aukg00528
    • 2021-12-04
    98 min

    390JAC-116 [Whole Body Sensitive Body X Beautiful Big Tits E Cup X Geki Saddle Climax = Monster Bomb! ] Transcendental Style God Kawa GAL Comes To Japan From The Land Of Fairy Tales! Saddle Many Times With A Spirit! !! Iki Crazy With A Hard Piston! S

  • amateur censoredcreampiesquirtingjacjac-116jac116390jac-116
    • 2021-12-18
    64 min

    H4610 ki211219 Mia Aoki 22years Old

  • amateur uncensoredh4610
    • 2022-01-08
    300 min

    [DVAJ-554]Best Work By Director Jo Asagiri

  • mari rika yu tomita censoredbeautiful girldramaDVAJalice japanjo asagiriDVAJ-554DVAJ554dvaj00554
    • 2022-01-14
    119 min

    [PPPD-994]A Special About Developing The Sexual Feelings Of A Natural Airhead With J-Cup Tits! Infinite Orgasms. Three Performances. Kurumi Momose

  • kurumi momose censoredbig titssquirtingPPPDoppaiPPPD-994PPPD994pppd00994



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored