stepfamily mature woman javcensored def jav




FC2SSNIHNDBBANWANZVENUPPPDMARASANCAWDMILKMIDVMEYDHMNVENXAMBIWAAABLKHDKAKSBJCJOD

2020-12-11
78 min

300MAAN-608 [Advent to drink a beautiful breast beauty gala with 100 transparency] Outstanding proportions on the baby face! A date to enjoy Yokohama with a cute and graceful beauty with a smile → Gala drinking 3P sex night ♪ The true identity of a c

  • amateur censoredcreampieamateurmaanmaan-608maan608300maan-608
    • 2020-12-18
    56 min

    444KING-021 Yuria-san

  • amateur censoredcreampiemarried womankingking-021king021444king-021
    • 2020-12-21
    149 min

    [AVSA-150]A New Generation Bisexual Cute And Lusty Transsexual A Shemale Lesbian x Clit & Cock Sensual Awakening S&M Breaking In Training

  • namiki touko beatrix censoredlesbianbdsmAVSAavs collector ssanpei yuyuavscollector sAVSA-150AVSA150avsa00150
    • 2020-12-24
    47 min

    [NYH-076]Horny MILF Trains Her Son's Friends' Eager Young Cocks Yurika Aoi

  • yurika censoredbig titsmilfNYHdirectorsdirectorsnyanjiang houseNYH-076NYH0761nyh00076
    • 2020-12-31
    118 min

    [SHKD-924]He Busted Out Of Jail To Spend Five Days Pumping This Unfortunate Wife Full Of His Creampies Tsumugi Akari

  • akari tsumugi censoredcreampiebeautiful girlSHKDattackerskitorune kawaguchisharkSHKD-924SHKD924shkd00924
    • 2021-01-01
    37 min

    [lady-361]せな(23)

  • amateur censoredamateurblowjobladylady-361lady361lady-361
    • 2021-01-03
    74 min

    FC2PPV 1630314 Mr. Tsubaki, who works at a long-established Japanese confectionery store and says “I like passionate and rich S ○ X ❤️❤️”, let me say hihi with two young cocks ❤️❤️

  • amateur uncensoredfc2
    • 2021-01-06
    75 min

    1Pondo 010621_001 Hospitality: A Taste of Rich Semen Dick Chisato Shirotaka Maki Koizumi Manami Ueno Rena

  • amateur uncensored1pondo
    • 2021-01-08
    70 min

    374SHOW-042 Kanon

  • amateur censoredamateurbeautiful girlshowshow-042show042374show-042
    • 2021-01-12
    140 min

    [KIRE-021]A Naive Mature Woman Faces The Subject Of Sex, Head On A Pure And Elegant Aroma Therapist Miki Mori 40 Years Old Her Adult Video Debut

  • miki mori censoredmature womansingle workKIREsod createryo inugamibeauty kirei sodKIRE-021KIRE0211kire00021
    • 2021-01-15
    58 min

    374SHOW-040 NENE

  • amateur censoredamateurshowshow-040show040374show-040
    • 2021-01-15
    201 min

    [SABA-672]Full Service With a Married Woman!! Erotic Oil Massage

  • censoredbig titsSABAskyu shirotohasshiSABA-672SABA672h-244saba00672
    • 2021-01-20
    37 min

    FC2PPV 1653059 [Personal shooting] No.027 Sakura-chan ★ A plump female college student whose boobs shake. She has a cute amateurish gesture and facial expression ★ [Complete appearance]

  • amateur uncensoredfc2
    • 2021-01-23
    59 min

    SIRO-4399 [First shot] [Signboard girl of a set meal shop] [Healthy naked body trembling jerky] A shy reaction that raises lust. If a simple girl with a serious personality also falls into pleasure .. AV application on the net → AV experience shootin

  • amateur censoredamateursirosiro-4399siro4399siro-4399
    • 2021-01-28
    60 min

    H0930 ki210128 Saeko Hamaoka 28years old

  • amateur uncensoredh0930
    • 2021-02-12
    141 min

    [FONE-134]She Needed The Cash: Tall, Busty Model With An Hourglass Figure - This College Girl Looks Barely Legal.

  • censoredcreampiebig titsFONEfirstplusFONE-134FONE134h-491fone00134
    • 2021-02-16
    138 min

    [KIRE-025]This Forty-Something Babe Is Spasmically Orgasming And Trembling Like A Newborn Deer!! 36 Orgasms! 3 Orgasmic Fucks! This Naive Mature Woman Is Getting Her Pussy Worked Over!! Miki Mori 40 Years Old

  • miki mori censoredmature womansingle workKIREsod createryo inugamibeauty kirei sodKIRE-025KIRE0251kire00025
    • 2021-02-17
    72 min

    [sika-031]こうちゃん(24)

  • amateur censoredcreampieamateursikasika-031sika031sika-031
    • 2021-02-20
    62 min

    [WKD-039]A Video Sex Record Of Adultery, Committed During A Married Woman Secret Meeting Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiebig titsWKDwaap entertainmentk westwWKD-039WKD0392wkd00039
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-27
    101 min

    [HONB-207]This Woman Has Small Tits. Blowjob Bitch Member 05-1, 20 Years Old

  • censoredamateurblowjobHONBmercurythe first shibuya special f e headquarHONB-207HONB207h-1133honb00207
    • 2021-03-11
    48 min

    FC2PPV 1721751 [No] Big breasts poverty graduate student who was in trouble with school expenses 1 Is it okay to have a vaginal cum shot with Sakichi？ ♥ ️ Limited number discount only now ※ Review privilege / Denma strong and bicubic masturbation ♥

  • amateur uncensoredfc2
    • 2021-03-25
    165 min

    [SPRD-1389]My Fuck Buddy Is My Friend's Mom Ayaka Makimura

  • ayaka makimura censoredbig titsmature womanSPRDtakara eizokon oriharualeddinSPRD-1389SPRD138918sprd01389
    • 2021-03-29
    61 min

    SIRO-4474 [First shot] [Beautiful legs of temptation] [Premature ejaculation female college student] The sexual desire of a female college student who was nervous explodes with SEX after a long absence. If you shake your hips with her wide open and e

  • amateur censoredamateursirosiro-4474siro4474siro-4474
    • 2021-03-29
    66 min

    492JCHA-061 I’ll do it again after a short break! 6

  • amateur censoredamateurbeautiful girljchajcha-061jcha061492jcha-061
    • 2021-04-06
    53 min

    200GANA-2465 In the spear room of the Nampa master of 100 battles, bring in SEX hidden shooting 198 Bring a beautiful woman who gently cares for drunkenness to the spear room and have sex! If you stroke her skin and suck it on her pink nipples, her b

  • amateur censoredamateurganagana-2465gana2465200gana-2465
    • 2021-04-06
    483 min

    [KTRA-291]Step Sister Love Sex With My Smooth Hairless Step Sister 10 Girls 8 Hours 2 Video Set

  • shinozaki mio shirasaki rei censoredsisterKTRAk tribeKTRA-291KTRA291h-094ktra00291
    • 2021-05-01
    240 min

    [HUNTB-007]"I Can See Your Nipples, Though...." "Really...？" Bathing With Your C***dhood Friend! You're Both Shy, So She's Covered Herself With A Towel, But... Her Nipple Shows Through, And Little By Little You Get Closer...

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-007HUNTB007huntb00007
    • 2021-05-20
    125 min

    [IENF-144]You Can Clearly See Th Shape Of Their Clits! Sexy Masturbation Over Panties With Repeated Orgasms 3

  • ena koume yu tomita censoredbig titsIENFienergyienfIENF-144IENF1441ienf00144
    • 2021-06-19
    87 min

    491TKWA-010 Yua

  • amateur censoredcreampieamateurtkwatkwa-010tkwa010491tkwa-010
    • 2021-07-01
    52 min

    324SRTD-0238 Geki Kawa OL Who Can Not Endure Frustration And Becomes Compliant

  • amateur censoredbig titssquirtingsrtdsrtd-0238srtd0238324srtd-0238
    • 2021-07-07
    63 min

    FC2PPV 1909531 ☆ First shot ☆ Complete appearance ☆ Fair-skinned mochi skin de M beautiful girl ♥ When the switch is turned on even though it is quiet, "No! ♪ I’ve done it until the second round ♥ [Individual

  • amateur uncensoredfc2
    • 2021-07-13
    45 min

    FC2PPV 1918266 Until 7/14 1980 → 1780pt [Individual Shooting] No71 Moe-chan, 18 Years Old, Ss-class Beautiful Girl Is Seriously Abdominal Muscles …

  • amateur uncensoredfc2
    • 2021-07-14
    58 min

    494SIKA-094 Ossan and SEX Next To My Boyfriend Who Doesn’t Wake Up Once Sleeping

  • amateur censoredcreampieamateursikasika-094sika094494sika-094
    • 2021-07-16
    61 min

    FC2PPV 1926164 An Innocent Girl Who Is Just 18 Years Old. She Licks A Mature Body And Shoots An Outburst On Beautiful Breasts With Soft Elasticity. Her First Raw Cock Makes Her Hips Squirt And Squirts A Lot, Panting With A Cute Voice And Finally Vagi

  • amateur uncensoredfc2
    • 2021-07-17
    137 min

    [JUL-653]"Hey？ Are You Really A Virgin？" - A married woman has continuous orgasms by virgin fraud - Maiko Ayase

  • maiko ayase maria sawaguchi censoredmature womansingle workJULmadonnajotaro tomiJUL-653JUL653jul00653
    • 2021-07-23
    235 min

    [SKMJ-191]My Unfaithful Wife's Afternoons... Her Sexy, Lusty Body Desperate To Fuck - Creampie Adultery...

  • censoredcreampiebig titsSKMJred face girlSKMJ-191SKMJ191h-1324skmj00191
    • 2021-08-20
    148 min

    [JUL-692]Young Employees With No Manners Turn Married Teacher Into A Slut. Business Manner Training G*******g. Maki Tomoda

  • maki tomoda censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-692JUL692jul00692
    • 2021-08-20
    162 min

    [CAWD-267]She Said Just 1 But She Comes Back For More Since She Can"t Forget The Pleasure! Ayami Emoto Gets Her First Creampie See Her Get Aroused To The Limit, Thrust After Thrust! After 5 Months, See Her Get Pounded Hard Like A Piston For Nonst

  • ayami emoto censoredcreampiesquirtingCAWDkawaiikyouseiCAWD-267CAWD267cawd00267
    • 2021-08-25
    86 min

    348NTR-034 Get A Cutie With Big Pie G Milk! I Think That There Is Something Wrong With It. In Fact, She Is His Cheating Partner! My Boyfriend Has A Favorite, So He Wants To Break Up With This Girl … She Doesn’T Know Such A Thing, And She De

  • amateur censoredcreampiebig titsntrntr-034ntr034348ntr-034
    • 2021-08-28
    158 min

    [JUKF-067]My Older Stepbrother Is My Spank Bank Material - Nonoka - Nonoka Sato

  • is it sato censoredcreampieschoolgirlJUKFjumpjump avJUKF-067JUKF067h-227jukf00067
    • 2021-09-10
    142 min

    [IPX-733]I"ve Got A Girlfriend Waiting For Me At Home, But When I Missed The Last Train, My Supervisor Said I Could Stay At Her Place... I Couldn"t Resist The Way She Looked Without A Bra Or Panties And We Wound Up Fucking All Night Long... H

  • hatsukawa minami censoredblowjobslutIPXidea pocketbungo maedadishIPX-733IPX733ipx00733
    • 2021-09-22
    65 min

    444KING-049 Meru

  • amateur censoredcreampiesquirtingkingking-049king049444king-049
    • 2021-10-01
    129 min

    [CAWD-287]Crazy Fuck Dripping In Sweat, Squirting, And Love Juice With Horny Stepdaughter, Yui Amane

  • amane yui censoredcreampiesingle workCAWDkawaiiasagiri jouCAWD-287CAWD287cawd00287
    • 2021-10-08
    98 min

    393OTIM-090 [Delusional Subjectivity] Pien-Based Kabukicho Slut Gal Ruru Arisu. (Ruru Arisu)

  • amateur censoredcreampieamateurotimotim-090otim090393otim-090
    • 2021-10-14
    79 min

    200GANA-2571 Seriously Nampa, First Shot. 1703 [Cheerful F Milk] Gentle Fair-Skinned Loose Fluffy Sister Who Cooperated With Asmr Recording! If It’s Not A Quiet Place … I’ll Lead You To The Studio And Have Sex! Mochimuchi’s Boobs

  • amateur censoredbig titssquirtingganagana-2571gana2571200gana-2571
    • 2021-10-17
    105 min

    413INST-175 Active H Cup Big Breasts Gravure College Age Before Her Debut Gonzo Video Outflow Creampie (Yume Natsuki)

  • amateur censoredcreampiebig titsinstinst-175inst175413inst-175
    • 2021-10-20
    53 min

    541AKYB-033 Hana (21) Such A Cute Girl! ？？ Gou Pubic Hair Girls Who Continue To The Buttocks! (Urara Kanon)

  • amateur censoredamateurbeautiful girlakybakyb-033akyb033541akyb-033
    • 2021-10-23
    147 min

    [LZPL-061]喉奥が性感帯の下品なイラマレズビッチ 佐伯由美香 新村あかり

  • yuka saeki akari shinmura censoredlesbiandeepthroatLZPLlez remasaki naolez re playLZPL-061LZPL061lzpl00061
    • 2021-10-30
    160 min

    [GS-2028]Taboos, A Married Woman Awakens To Her Fetishes, No. 03 Continued, True Stories, And Fakecest [49]

  • niwa sumire censoredmarried womanlesbianGSgo go zukaraki take shigosGS-2028GS2028
    • 2021-11-01
    150 min

    [DOKS-548]A Video Dedicated To Masturbation To Beautiful Legs In Panty Stockings, Filmed By Pantyhose Lovers

  • seina rurucha censoredslutDOKSoffice k smatsumoto chrysalisDOKS-548DOKS54836doks00548
    • 2021-11-03
    129 min

    300MIUM-761 [Intelligent G Cup] Its Milk And Constriction Venus Class! Enjoy The Artistic Golden Ratio Body Of A Sober Curator With That Skill. (Nakamura Here)

  • amateur censoredbig titsamateurmiummium-761mium761300mium-761
    • 2021-11-16
    63 min

    [111621-001]The Girl Who Seduce With Her Beautiful Boobs

  • nanaha tomori uncensoredcreampiehandjobcaribbeancom
    • 2021-11-19
    242 min

    [HUNTB-144]"You Can"t Masturbate To Any Girl But Me!" Says My Strict Girlfriend. I Want To Break Up With Her, So I Ask Her To Let Me Film Her With Her Friends Instead

  • censoredcreampieblowjobHUNTBhunterkawajirihhh groupHUNTB-144HUNTB144huntb00144
    • 2021-11-20
    132 min

    [SCPX-436]My Step Father-in-law Suddenly Kissed Me So Well That I Lost My Back And Felt My Body Warp, And My Earnest Wife Instantly Turned Into A Female In Heat!

  • censoredcreampieSCPXscoophasshimousouzokuSCPX-436SCPX436scpx00436
    • 2021-11-30
    120 min

    [SAN-031]A Florist"s Plundering Love! A Wife"s Thoughts In The Language Of Dahlia Flowers

  • squid censoredsingle workdramaSANmazakisakura kabinmother mazaSAN-031SAN031h-796san00031



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored