stepmom censored mature woman jav married




FC2MVSDSSISHDKAMEYDPREDAPODROYDNACRSANVENUABWPPPDSPRDADNMARACESDMILKGVHSSNIMIAA

2020-09-20
116 min

[HND-888]Making Babies With My Girlfriend's Sister Hikaru Harukaze

  • spring breeze censoredcreampiebig titsHNDhon nakausa pyonHND-888HND888hnd00888
    • 2020-09-23
    75 min

    374SHOW-027 Mika

  • amateur censoredbig titsamateurshowshow-027show027374show-027
    • 2020-09-28
    38 min

    S-Cute mki_004 Gonzo H / Kanon that connects with a beautiful girl in uniform for a long time

  • kanon censoredschoolgirlamateurmkimki-004mki004mki-004
    • 2020-10-08
    53 min

    [h0930-ki201008]椎名 真紀 34歳

  • amateur uncensoredh0930
    • 2020-10-16
    107 min

    [MXGS-1157]I'm A Man, After All! I Can't Stop Lusting Over My Female Friend Who U*********sly Seduces Me! Yui Kawai

  • yui kawai censoredbeautiful girlsingle workMXGSmaxingikei keihaMXGS-1157MXGS1157h-068mxgs01157
    • 2020-11-06
    114 min

    [SHKD-911]She Was Trying To Avenge Her Father, But... This Female Detective Was Captured By The Sinister Organization, And Subjected To Sex For A Year Minori Hatsune

  • hatsune minori censoredbig titssingle workSHKDattackerskinsharkSHKD-911SHKD911shkd00911
    • 2020-11-09
    55 min

    FC2PPV 1564054 Genuine idol super dangerous video ★ First and last work ★ One night only mistake she made

  • amateur uncensoredfc2
    • 2020-11-13
    50 min

    FC2PPV 1568837 [Personal shooting] Two other sticks that my husband eats while taking his daughter to the hospital. This is Ji Po addiction …

  • amateur uncensoredfc2
    • 2020-11-20
    104 min

    [GREDB-1019]Love Scandal/Emi Takayama

  • censoredbig titsbeautiful girlGREDBintec incGREDB-1019GREDB1019h-706gredb01019
    • 2020-11-29
    79 min

    [BAB-017]This Lingerie Shop Girl Wanted Some Raw Sex

  • censoredbig titsblowjobBABbabylon daydreamersBAB-017BAB017bab00017
    • 2020-12-01
    120 min

    [NACR-370]My Mother-In-Law Toyed With My Heart Tsubasa Hachino

  • yano tsubasa censoredcreampiemarried womanNACRplanet pluscherryshichidomeNACR-370NACR370h-237nacr00370
    • 2020-12-01
    139 min

    [SDAB-156]Total Obedience Sex And Raw Fucking Creampies With A Beautiful Y********l In Uniform Marina Saito

  • marina saito censoredcreampieschoolgirlSDABsod createbacon tanakaone s youthSDAB-156SDAB1561sdab00156
    • 2020-12-03
    70 min

    10musume 120320_01 Nasty massage experience for the first time Megumi Sakashita

  • amateur uncensored10musume
    • 2020-12-04
    176 min

    [YMDD-214]Confidential! Fleshlight Wife, An OL That Isn't Allowed To Telework! The Reason Why Can't I Leave The Office. Miya Tanaka

  • miya tanaka censoredcreampiedeepthroatYMDDmomotarou eizou shuppanhimurokkujaku momoYMDD-214YMDD214ymdd00214
    • 2020-12-06
    154 min

    [DNJR-040]The Slut And The Crossdresser - Horny Female Teacher Turns Crossdressing S*****t Into Her Very Own Fuck Toy Sui Mizumori Riku Mukai

  • aoi mizumori coming censoredslutDNJRdog delusion groupmaboroshikoDNJR-040DNJR040dnjr00040
    • 2020-12-20
    136 min

    [HND-921]She's Fucked 300 Guys In Chiba Alone! Super Sexy Tanned Slut Wants To Make Memories By Taking Your Creampie - Her Porn Debut Rio Sakune

  • sakune rio censoredcreampiesingle workHNDhon nakamametaro mamezawaHND-921HND921hnd00921
    • 2020-12-24
    39 min

    FC2PPV 1618314 [Personal shooting] ♀ 250 Reading More ◯ -chan 18 years old SP01 2020 Christmas special edition! A beautiful girl is conceived as a child seed juice gift (laughs)

  • amateur uncensoredfc2
    • 2021-01-09
    118 min

    [MEYD-650]I Am Actually Continuously Being Fucked By My Husband's Boss... Karen Otoha

  • karen otoha censoredcreampiesquirtingMEYDtameike gorokazumaMEYD-650MEYD650meyd00650
    • 2021-01-09
    48 min

    279UTSU-477 Yukino

  • amateur censoredmarried womanamateurutsuutsu-477utsu477279utsu-477
    • 2021-01-20
    22 min

    FC2PPV 1652349 [Personal shooting] Affair with a young slender married woman. Insert the underwear from the side of the pants and make vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-01-23
    240 min

    [REXD-349]Girls Holding It In - Tied Up On The Station Toilet... "I Can't Hold It Any Longer... I'm Going To Wet Myself..."

  • censoredcreampieamateurREXDredmanji groupREXD-349REXD349rexd00349
    • 2021-01-26
    80 min

    200GANA-2425 Seriously Nampa, first shot. 1587 Get a G-Cup Sales Lady in a Muchimuchi Suit! Super erotic amateur ww who is in agony while shaking plump boobs with pantyhose breaking sex

  • amateur censoredbig titsamateurganagana-2425gana2425200gana-2425
    • 2021-02-12
    160 min

    [MDBK-158]Total Baby Plays!! A Big Tits Uncertified Nursery School For Adults 4

  • inaba arioka miu censoredcreampiebig titsMDBKbazookarakudaMDBK-158MDBK158h-1496mdbk00158
    • 2021-02-18
    86 min

    [REBD-533]Rena Illusion: Gen Momohana/Reina Toen

  • reina taoyuan censoredsingle workREBDrebeccachikara sawamuraREBD-533REBD533h-346rebd00533
    • 2021-02-20
    240 min

    [YSAD-048]I'm About To Defile This Girl's Oral Orifice

  • airi mashiro shitara arisa censoredcreampieYSADlight night butterflyYSAD-048YSAD048540ysad00048
    • 2021-03-02
    49 min

    FC2PPV 1708176 [Uncensored individual shooting] Active model of F cup beautiful breasts wants a meat stick

  • amateur uncensoredfc2
    • 2021-03-02
    35 min

    318LADY-364 Misaki

  • amateur censoredamateurladylady-364lady364318lady-364
    • 2021-03-18
    77 min

    FC2PPV 1731348 [No appearance] "Raw is useless …" Unauthorized raw squirrel by a neat and slender beauty. Reason collapsed by being pierced by the uterus with a raw dick.

  • amateur uncensoredfc2
    • 2021-03-27
    239 min

    [MCSR-433]Slutty Cougars Widows Get Fucked In Front Of Portraits Of Their Dead Husbands 8 Women 4 Hours

  • censoredcreampiemature womanMCSRbig morkalguo masumascottMCSR-433MCSR43357mcsr00433
    • 2021-04-01
    141 min

    [ID-030](Beloved Escort) I Ordered An Escort Who Normally Works As A C***dcare Worker (Cute) Momo Watanabe Momoka Watanabe

  • ruri kuribayashi ayaka tomoda censoredcosplayIDplumposter rawgunzshirouto only plumID-030ID0305521id00030
    • 2021-04-09
    120 min

    [MEYD-671]Porn Label Puts Out A Wanted Ad For A "Film-Related" Part-Time Job. Married Woman Actress Just Started Working As An Assistant Director, But Ends Up Making Her Porn Debut Lily Hart

  • lily heart censoredsingle workdramaMEYDtameike gorohirokoji osakiMEYD-671MEYD671meyd00671
    • 2021-04-12
    126 min

    [GONE-032]Big Tits Lifesaver Loves Sex! Unstoppable Libido

  • censoredcreampiebig titsGONEmercurysmuGONE-032GONE032h-1133gone00032
    • 2021-04-15
    120 min

    [KAGP-179]A Naked Field Guide To Amateur Girls 17 - 12 Modern Sluts In The Buff Thoroughly Filmed Just For Kinky Gentlemen's Nudes Collections

  • censoredamateurbeautiful girlKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-179KAGP179kagp00179
    • 2021-04-22
    124 min

    [HAVD-1007]The Kissing Lesbian Series, Drenched In Adult, Rich And Thick Drool This Horny Babe is Flipping Her Lust To Max Levels And Jumping Head First Into Horny Lesbian Sex!

  • maki kyoko yumina hirosaki censoredlesbianHAVDhibinodr torihamaHAVD-1007HAVD10071havd01007
    • 2021-04-29
    95 min

    [IQQQ-023]A Married Teacher Gets 10x Wet In An Orgasm Class Where She Can't Make A Sound! Yumiko Sakura

  • yumiko sakura censoredcreampiemarried womanIQQQcenter villagejiro fukagawazora center villageIQQQ-023IQQQ023h-086iqqq00023
    • 2021-05-03
    59 min

    10musume 050321_01 A Cute Influencer is Interested in Adult Toys Yuko Takano

  • amateur uncensored10musume
    • 2021-05-03
    30 min

    FC2PPV 1800043 [Limited quantity] Although it was a private video, it will be released. (With bonus Instagram ID)

  • amateur uncensoredfc2
    • 2021-05-08
    118 min

    [SCOP-720]This Life Insurance Sales Lady Came To Pay Me A Visit, And To My Surprise, She Wasn't Wearing A Bra Or Panties!？ I Was 120 Prepared To Turn Her Down, But Now My Cherry Boy Cock Was Rock Hard And Ready And Unable To Resist, So I Put My S

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-720SCOP720scop00720
    • 2021-05-15
    115 min

    [MRSS-112]A Cuckolding Babymaking Vacation I Went With My Wife On A Vacation So That We Could Try To Make Babies While She Was Ovulating, But Then This Male College S*****t Creampie Fucked Her Instead Amu Hanamiya

  • hanamiya amu censoredcreampiebig titsMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-112MRSS112mrss00112
    • 2021-05-17
    77 min

    259LUXU-1394 Luxury TV 1405 Big Breasts Gravure Who Was Fascinated By Having Sex While Being Taken In The Last Shooting And Playing Only In AV Is Re-Appearing! !! Unleashed from her tension, she is enthusiastic about blaming herself this time. She le

  • amateur censoredbig titsamateurluxuluxu-1394luxu1394259luxu-1394
    • 2021-06-04
    165 min

    [ATID-464]Dancer Gets Her Asshole Fucked Miu Oka

  • miwa sakura censoredanalsingle workATIDattackersusubashisuiin madATID-464ATID464atid00464
    • 2021-06-16
    124 min

    [MVSD-470]Passionate And Pure Adulterous Sex Only One Time A Year! The Writer, The Wife, And The Lover (Editor) Jun Harumi

  • jun shunmei censoredcreampiesingle workMVSDm s video groupMVSD-470MVSD470mvsd00470
    • 2021-06-17
    98 min

    [BGSD-415]Hidden Beauties Revolution - Aika Kamijo

  • kamijou aika censoredbeautiful girlsingle workBGSDbaguschikara sawamuraBGSD-415BGSD415h-305bgsd00415
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-25
    238 min

    [BMW-236]Super Squirting Pussy! Convulsing And Trembling Orgasms From Pumping Piston Fuck Best!

  • bud julia censoredcreampiebeautiful girlBMWwanz factorywanzBMW-236BMW236bmw00236
    • 2021-07-25
    38 min

    FC2PPV 1939487 [Individual Shooting 52] Young Lady Private K3 Daughter ☆ Secretly Half-Out Half-Creampie And Pregnant Contact At A Later Date [With Bonus]

  • amateur uncensoredfc2
    • 2021-08-06
    163 min

    [IPIT-020]Adoration For Japanese Porn! A Half Swedish Beautiful Girl Who Loves The Showa Period Makes Her AV Debut. Uika Noa

  • squid censoredsquirtingblowjobIPITidea pocketmamezawa mametarouaipoke itsuzai hakkutsu projectIPIT-020IPIT020ipit00020
    • 2021-08-12
    134 min

    [JRZE-068]First Time Filming My Affair. Rieko Masaki.

  • rieko masaki censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-068JRZE068h-086jrze00068
    • 2021-08-21
    244 min

    [XRLE-015]Climax Fuck With Innumerable Cocks! Drity Secret Orgy 4 Hour Highlights

  • mizuno chaoyang nozomi hazuki censoredanalcreampieXRLEk m producereal real worksXRLE-015XRLE015xrle00015
    • 2021-09-04
    156 min

    [LULU-090]Getting Fucked By My Son"s Friend Over And Over All Day Yukino Nagisa

  • yukino nagi censoredcreampiebig titsLULUlunaticsruminakkusuLULU-090LULU090lulu00090
    • 2021-09-23
    273 min

    [SVDVD-877]Shame! Naked Youth Strength Measurement 2021

  • ito meru yuki s censoredbeautiful girlSVDVDsadistic villageistshuuchi musumeSVDVD-877SVDVD8771svdvd00877
    • 2021-10-01
    120 min

    [HODV-21611]My Husband Doesn"t Ever Want To Fuck Me, Now My Terrible Younger CEO At Work Takes Me In For Dominant Sex. NTR Cheating Scenario. Mizuki Yayoi

  • mizuki yayoi censoredcreampiebig titsHODVh m pvotomsHODV-21611HODV216115642hodv21611
    • 2021-10-13
    83 min

    259LUXU-1449 Luxury TV 1469 In Contrast To The Gentle And Gentle Atmosphere, An Older Sister Who Has A Wealth Of One-Night Experience And A Commitment To Physical Compatibility Has Appeared. As She Said, "I Like To Lick", I Tasted The Big Coc

  • amateur censoredbig titsamateurluxuluxu-1449luxu1449259luxu-1449
    • 2021-10-16
    82 min

    FC2PPV 2351648 Saddle Tide Does Not Stop Intense Chewy Explosion Beautiful Girl! The Tide That Constantly Overflows From Sujiman Eventually Becomes Rain And Returns To The Ground. This Is The Water Planet, The Earth. [Ultra-Highest Quality Gonzo] Lim

  • amateur uncensoredfc2
    • 2021-11-02
    53 min

    188HINT-0485 Teruyo

  • amateur censoredcreampiemarried womanhinthint-0485hint0485188hint-0485
    • 2021-11-27
    71 min

    C0930 tk0047 Yuuna Nagashiro 27years old

  • amateur uncensoredc0930



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored