titty fuck big tits javcensored slut censored




FC2RBDBBANHZGDKSBJMIDEHNDSDABHODVMILKMVSDAVSANATRMEYDGMEMFSDSSAWDMARAAPODSPRDNGOD

2020-12-02
135 min

[GVH-161]The Fully Nude Hot Spring Resort Inn From The Moment You Arrive Until Your Departure, This Big Tits, Big Ass, Shaved Pussy Madam And Servant Will Serve You With Naked Hospitality

  • arisa hanyu arisu hanyu airi takasaka censoredbig titsGVHglory questpoison pillGVH-161GVH16113gvh00161
    • 2020-12-09
    133 min

    POW-035 Zono

  • amateur censoredbig titsschoolgirlpowpow-035pow035pow-035
    • 2020-12-12
    38 min

    FC2PPV 1604176 Limited to 3 days [Individual] A sober and glassesy busty wife. It is violated by a virgin with a large amount of debt and it is made vaginal cum shot many times with a hard cock.

  • amateur uncensoredfc2
    • 2020-12-24
    84 min

    [IENF-116]Elegant Married Women With Big Tits Take Young Guys' Virginities! - Cherry Boys Gently Take The Lead For Their First Experiences As These Goddesses Let Themselves Get Fucked And Creampied!

  • censoredcreampiebig titsIENFienergyienfIENF-116IENF1161ienf00116
    • 2021-01-02
    122 min

    [UMD-762]Undercover! The Lymph Massage Parlor Everybody's Talking About 5 "How About Our Secret Options？"

  • kimishima mio natsu tojo censoredblowjobhandjobUMDleodragon nishikawaUMD-762UMD762125umd00762
    • 2021-01-09
    120 min

    390JAC-077 [The most 17 shots in the series x Creampie bukkake barrage] A female dentist with a super lewd face and contents is coming! !! “I want to be surrounded by penises and bukkake …” It’s a festive ruckus with continuous In

  • amateur censoredcreampiesquirtingjacjac-077jac077390jac-077
    • 2021-01-31
    50 min

    493PKPD-080 [Odorless] Make a female K student squid with a big cock! Convulsions climax hell

  • amateur censoreduniformamateurpkpdpkpd-080pkpd080493pkpd-080
    • 2021-02-05
    122 min

    [UMD-766]Perverted Gynecologist!! 12 A Young Wife Who Doesn't Know Anything Gets A Creampie Instead Of Treatment!!

  • nene tanaka rumi tadami censoredbig titssquirtingUMDleodragon nishikawaUMD-766UMD766125umd00766
    • 2021-02-12
    136 min

    [CHN-197]New: We Lend Out Amateur Girls. 95 (Pseudonym) Suzune Akimoto (Grocery Store Clerk) Age 20

  • akimoto suzune censoredanalslutCHNprestigemanhattan kimurataiCHN-197CHN197118chn00197
    • 2021-02-12
    158 min

    [MIDE-886]Sweet, Beautiful Girl With An Adorable Accent Takes On Her First Client At A Soapland Brothel Nozomi Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyzhirokoji osakimoodyz divaMIDE-886MIDE886mide00886
    • 2021-02-18
    225 min

    [HUNTA-956]"That Wasn't My Intention, But ...." She Talks And Acts And Looks Like One Of The Guys, But She's The Only Girl At This Gathering Of Men. And Gradually ...

  • censoredblowjoblingerieHUNTAhunterspace nyanjirohhh groupHUNTA-956HUNTA956hunta00956
    • 2021-02-26
    42 min

    [CLO-132]The Coercion Of A Receptionist The Target: Ai Ai Minano

  • ai minano censoredCLOchobitchchovicCLO-132CLO132h-1435clo00132
    • 2021-02-27
    76 min

    230OREC-703 Mao

  • amateur censoredcreampiebig titsorecorec-703orec703230orec-703
    • 2021-02-28
    131 min

    [ARAN-016]I'm Going To Have Sex With You The Orgasm Research Center A Secret Project To Transform Women's Bodies Through Lusty Instruments And Powerful Aphrodisiacs Project-1 A College Girl Athlete With Little Experience With Men Is Given Som

  • censoredcreampieARANbabyentertainmentamateurARAN-016ARAN016aran00016
    • 2021-03-01
    48 min

    FC2PPV 1706939 Infiltrate a woman’s house ★ 19-year-old neighborhood college student who matched with Tinder wants to be 〇 by a stranger Big tits metamorphosis beauty ★ First time limited unauthorized vaginal cum shot SEX video [37 minutes] 1 gi

  • amateur uncensoredfc2
    • 2021-03-07
    110 min

    [ANB-185]I Became My Stepmom's Sex Toy A Horny Hot Mother-In-Law With Colossal Tits And An Explosive Ass! Asahi Nishiyama

  • asahi nishiyama censoredbig titsmature womanANBrubysusumu yanokuchinobleANB-185ANB185anb00185
    • 2021-03-17
    37 min

    492MERC-289 Chemical Party Video

  • amateur censoredcreampieamateurmercmerc-289merc289492merc-289
    • 2021-03-19
    190 min

    [DOCP-280]"I'll Do Anything You Need Me To, Okay？" I Got Laid Up From An Injury And My Younger Stepsister Was Left To Bathe Me! I Got Hard When She Cleaned Under My Stuck Foreskin, And This Made Her So Horny That She Couldn't Hide It

  • moe hazuki saya matsui censoredcreampiebig titsDOCPprestigedoc premiumDOCP-280DOCP280118docp00280
    • 2021-03-27
    50 min

    FC2PPV 1743145 [Personal shooting main story appearance] 20-year-old hostess Mayu-chan’s Gonzo cum shot and the message was lost

  • amateur uncensoredfc2
    • 2021-03-30
    107 min

    261ARA-484 [Woman’s Flowering Declaration] 23 years old [Beauty Public Relations Department] Rui-chan is here! The reason for her application that she will appear on AV on the way home from work is "I want you to bloom as a woman ♪" The

  • amateur censoredbig titsamateuraraara-484ara484261ara-484
    • 2021-04-06
    483 min

    [KTRA-291]Step Sister Love Sex With My Smooth Hairless Step Sister 10 Girls 8 Hours 2 Video Set

  • shinozaki mio shirasaki rei censoredsisterKTRAk tribeKTRA-291KTRA291h-094ktra00291
    • 2021-04-21
    60 min

    Caribbeancom 042121-001 Rubbing Herself Pussy : Cum a lot if I move Yukie Natsuki

  • yukie natsuki uncensoredcreampiebukkakecaribbeancom
    • 2021-04-24
    138 min

    [JJBB-010]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 10

  • censoredcreampiemature womanJJBBjukujo japanJJBB-010JJBB010jjbb00010
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    150 min

    [SSIS-061]Pleasure! Sexy Model Fucks 3 Times Kaoru Yasui

  • kaoru yasui censoredbig titssquirtingSSISs1 no 1 stylemon cSSIS-061SSIS061ssis00061
    • 2021-05-10

    FC2PPV 1810325 First shot !! Limited number [Uncensored] D cup that has just become a nursery teacher this spring! ︎ Pretty disturbed back face … 2 times vaginal cum shot (feature)

  • amateur uncensoredfc2
    • 2021-05-18
    46 min

    396BIG-102 Ayaka

  • amateur censoredcreampieamateurbigbig-102big102396big-102
    • 2021-06-11
    199 min

    [IPX-673]If You Can Handle The Pure Heart Beauty Karen's Vacuum Blowjob For 5 Minutes, You Get To Have As Much Sex As You Want With The Real Kaede Karen In Shibuya

  • karen kaede tsuji kanon censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-673IPX673ipx00673
    • 2021-06-12
    78 min

    200GANA-2501 Seriously Nampa, first shot. 1647 Show off magic to girls in Harajuku! Bring an interested girl to the hotel! Guide in the erotic direction with magic using condoms! The slender long legs and the crisp buttocks are exposed and disturbed!

  • amateur censoredamateurganagana-2501gana2501200gana-2501
    • 2021-07-14
    61 min

    494SIKA-096 3P Sex With A Beautiful Girl With No Makeup

  • amateur censoredcreampieschoolgirlsikasika-096sika096494sika-096
    • 2021-07-22
    190 min

    [BGN-065]新人 プレステージ専属デビュー 神谷凪 【MGSだけのおまけ映像付き 10分】

  • amateur censoredbig titsamateurbgnbgn-065bgn065bgn-065
    • 2021-07-22
    21 min

    HEYZO 2573 Erotic Massage for Amina – Amina Minami

  • amina minami uncensoredblowjobhandjobheyzo
    • 2021-07-29
    66 min

    OREX-278 Noa

  • amateur censoredcreampiebig titsorexorex-278orex278orex-278
    • 2021-08-12
    67 min

    336KNB-167 I’M Living Separated From My Husband … A Young Wife With Big Tits Who Feels Good And Squeals! I Will Take A Gonzo With This Married Woman From Now On. 60 At Takao Station, Hachioji, Tokyo

  • amateur censoredbig titsmarried womanknbknb-167knb167336knb-167
    • 2021-08-26
    482 min

    [FCDSS-013]Nene Yoshitaka FALENO Exclusive First Best 8 Hours Please Look At Me Who Is Honest When Fucking

  • nine yoshitaka censoredslutFCDSSfalenofaleno starFCDSS-013FCDSS0131fcdss00013
    • 2021-09-04
    123 min

    [BIJN-206]The Documenting Of Full Climax Of A Cute Little Devil Wife Jerking And Screaming While Cumming Madly Mitsuki Nagisa

  • scooping censoredcreampiesingle workBIJNbijin majoBIJN-206BIJN206bijn00206
    • 2021-09-10
    157 min

    [BBAN-342]My Manager Is A Big Tits Nipple Teasing Lesbian. A Big Tits New Company Hire Who Climaxes From Her Manager"s Countless Intensive Nipple Teasing Nenne Ui Yuria Yoshine

  • first love yoshine yuria censoredbig titslesbianBBANbibianBBAN-342BBAN342bban00342
    • 2021-09-11
    226 min

    [BAZX-306]Dirty POV Sex With An Admired Coworker vol. 003

  • censoredBAZXk m producetodobazookaBAZX-306BAZX306bazx00306
    • 2021-09-16
    114 min

    [FANH-006]TV Presenter-like Neat and Clean Slender Beautiful Woman Ema-san. Oiled Up Strong Orgasms With 2 Non-stop Cum Loads!

  • censoredamateurblowjobFANHhamedori.network secondeditionFANH-006FANH006h-1472fanh00006
    • 2021-10-02
    69 min

    533NNS-011 Skyscraper Masturbation Leaked Video! !! A Gal And Nasty Dovich Shop Clerk Has A Continuous Vaginal Cum Shot During Lunch Break And A Rich Service Customer Service! !! It’s Too Hard … The Best! !!

  • amateur censoredcreampiebig titsnnsnns-011nns011533nns-011
    • 2021-10-06
    76 min

    476MLA-052 3p First Experience While Shiroto Girls Are Bewildered! Peeing With A Neat Appearance! !! Facial Cum Shot And Vaginal Cum Shot That A Sensitive Busty Beauty Member Received In Exchange For A Large Reward

  • amateur censoredcreampiebig titsmlamla-052mla052476mla-052
    • 2021-10-09
    141 min

    [APAK-201]"My Trip With My Teacher Ended In Lots Of Sex And Giving Him Head Until My Throat Was Sore..." A Hot Springs Vacation With A Submissive S*****t, Starring Atsuko Nakajima

  • atsuko nakajima censoredcreampieschoolgirlAPAKaurora project annexrkAPAK-201APAK201apak00201
    • 2021-10-30
    55 min

    [HEYZO-2647]Yui Kisaragi My Porcelain Skin GF Gets Fucked By Neighbour Old Fart

  • yui kisaragi uncensoredcreampiehandjobheyzo
    • 2021-11-06
    118 min

    [MOPT-012]This Long-Legged Lady Likes To Bully A Maso Man Pantyhose, Jeans, And Knee-High Boots Nanako Miyamura

  • nanako miyamura censoredanalslutMOPTm o paradisemo tightMOPT-012MOPT012mopt00012
    • 2021-11-12
    38 min

    359TYVM-208 For A Lewd Wife Who Erects A Nipple While Enchanted By A Fine Cock … ●● Creampie! (Yu Koizumi)

  • amateur censoredcreampiemarried womantyvmtyvm-208tyvm208359tyvm-208
    • 2021-11-15
    50 min

    [SHH-031]Naughty Massage Parlor Slut Secretly Rubs Your Cock While Calmly Giving You A Massage While Your Wife Is Right Beside You. Then She Slips Your Dick Inside Her And Rides You Cowgirl Style Until You Give Her A Creampie

  • censoredslutSHHnatural highkansukeSHH-031SHH0311shh00031
    • 2021-11-19
    200 min

    [HUNTB-150]"It"s Not Sex If It"s Through The Underwear Right？ So Put It In..." I Put It In My Younger C***dhood Friend Who Wanted To Play Sex In Underwear!

  • censoredcreampieschoolgirlHUNTBhuntervolvo nakanohhh groupHUNTB-150HUNTB150huntb00150
    • 2021-11-20
    240 min

    [GIGL-664]From-Above Footage: Cheeky Married Woman Coming From The Piston Action Of A Weakling 2

  • censoredcreampiebig titsGIGLgigolo gigologigoloGIGL-664GIGL664gigl00664
    • 2021-11-23
    56 min

    FC2PPV 2455853 [Thank You For Selling 670 Bottles] Debt 200. A Married Woman Who Lives In K City And Reopens The Repayment. She Blames Her Thoroughly And Blames Her About 100 Times. At The End She Made It Into A Horny Wife Who Is Also Good At Anal.

  • amateur uncensoredfc2
    • 2021-12-03
    121 min

    [JJDA-024]A Kind And Gentle Big Tits Wife Is Letting A Hard-Working Fully Erect Cherry Boy S*****t Fuck Her Behind Her Husband"s Back Nene Tanaka

  • nene tanaka censoredcreampiebig titsJJDAjukujo daigaku jukujo manjigroupJJDA-024JJDA024jjda00024
    • 2021-12-03
    240 min

    [CLUB-661]We Went Picking Up Girls And Took Home This Friendly Pair Of Girls We Met At An Izakaya. If We Quietly Have Sex, Will Their Tight-Legged Friends In The Next Room Get Horny And Let Us Fuck Them Too？ 29

  • censoredsquirtingCLUBhentai gentleman clubCLUB-661CLUB661club00661
    • 2021-12-09
    144 min

    [NHDTB-609]Lewd Cafe Girl Lineup 3. Obedient Servers Are All Lined Up In A Row During Business Hours To Offer Lewd Service To Their Customers.

  • censoredNHDTBnatural highrafting maeshiroNHDTB-609NHDTB6091nhdtb00609
    • 2021-12-23
    125 min

    [ARMF-021]Full Body Female Body Pictorial Book Showing While Masturbating Instruction No.1

  • rurucha kagura rin censoredanalARMFaroma planningfemale body fetishismARMF-021ARMF021armf00021
    • 2021-12-25
    151 min

    [GNAX-062]A Married Woman Screaming In Broad Daylight Who Can Never Show Her Husband First Time Filming Document Version Sayuri Akiyoshi 36 Years Old

  • akiyoshi sayuri censoredcreampiesingle workGNAXnagiranagira kenzonagira nagiraGNAX-062GNAX062gnax00062
    • 2022-01-04
    61 min

    1Pondo 010422_001 Braless Neighbor In The Morning: Non Suzumiya

  • amateur uncensored1pondo
    • 2022-01-05
    62 min

    SPAY-032 Mr. Nakamura

  • amateur censoredcreampiebig titsspayspay-032spay032spay-032



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored