uniform javcensored creampie censored




FC2AUKSVENUMEYDONEZHUNTBDASDMIAAABWKBICHRVBLKNACRADNSSISFSDSSWAAAAVSACAWDNNPJLULU

2020-11-19
49 min

299EWDX-331 The newlywed G-cup wife is still working hard to get pregnant, so she is always in estrus

  • amateur censoredcreampiebig titsewdxewdx-331ewdx331299ewdx-331
    • 2020-11-19
    151 min

    [PPPD-882]Twin High-Class Lingerie Salesgirls Seduction - Haru Kawamura Inori Fukazawa

  • kawamura haru fukasawa inori censoredbig titsslutPPPDoppaiPPPD-882PPPD882pppd00882
    • 2020-11-22
    117 min

    [JUL-377]Married Woman Secretary, Creampie Fuck In The Manager's Office Full Of Sweat And Kissing Industry's Top Beautiful Mature Woman Appointed As Madonna's Exclusive Secretary!! Marina Shiraishi

  • rena shiraishi censoredcreampiebig titsJULmadonnanagaeJUL-377JUL377jul00377
    • 2020-12-04
    240 min

    [SOUD-016]Athletic Girls Getting Fucked Wearing Their Sweaty Uniforms, Their Fit, Tight Pussies Expertly Milking Every Drop Of Semen!!

  • censoredamateurcosplaySOUDprestigebest fuckingSOUD-016SOUD016118soud00016
    • 2020-12-08
    80 min

    200GANA-2400 Seriously Nampa, first shot. 1565 Feeling like a floating lady! A love interview with a neat female college student! The bottom story sticks into the absurd body, and the heart that gradually unravels … If you notice it, you will be

  • amateur censoredamateurganagana-2400gana2400200gana-2400
    • 2020-12-17
    235 min

    [HUNTA-915]"If You Want To Do Naughty Stuff You Can Use My Body However You Like. It'll Be Good Practice For Me Too..." Still A Cherry Boy, I Get To Use My Younger Step-Sister's Body For Sex Practice! Lil Sis Just Keeps Getting Cuter.

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-915HUNTA915hunta00915
    • 2020-12-20
    119 min

    [DASD-783]A Doe-Eyed Natural Airhead Married Woman Elder Sister Type Who Can't Say No Doesn't Realize That She's Been Luring Men To Temptation. Yuria Satomi

  • satomi yuria censoredcreampieslutDASDdasrokusaburo mishimaDASD-783DASD783dasd00783
    • 2020-12-20
    160 min

    [AKID-079]College Girls Only - Taken Home For A Fuck After A Party - Voyeur Footage Secretly Sold As Porn No. 43 - Naughty Horny Sluts Take Creampies Edition - Asami, D-Cup, 21 Years Old (Nympho, Tanned, Bad Girl) Sarina, I-Cup, 21 Years Old (Horny,

  • censoredcreampieslutAKIDomochikaeri mousozokumanji groupAKID-079AKID079akid00079
    • 2020-12-20
    30 min

    FC2PPV 1613260 A beautiful nurse model shooting a lascivious shaved pussy sticking to a cock and a cock is stimulated, … [Amateur individual shooting original FHD high quality ZIP download available]

  • amateur uncensoredfc2
    • 2020-12-25
    47 min

    416SVMM-038 Mirei

  • amateur censoredcreampiesquirtingsvmmsvmm-038svmm038416svmm-038
    • 2021-01-15
    62 min

    SIRO-4392 [First shot] [Nasty x Married woman x Obscene ass] [Married woman of the president’s secretary] An elegant president’s secretary appears. A frustrated wife who has left a nasty body is given a cum many times .. AV application on t

  • amateur censoredmarried womanamateursirosiro-4392siro4392siro-4392
    • 2021-01-22
    26 min

    [BTH-109]What If Your Stepmom... Reiko Makihara

  • reiko makihara censoredblowjobmature womanBTHchobitchchovicBTH-109BTH109h-1435bth00109
    • 2021-01-22
    73 min

    [orex-181]まいさん

  • amateur censoredcreampieamateurorexorex-181orex181orex-181
    • 2021-01-27
    52 min

    230OREC-674 Suzu

  • amateur censoredcreampieamateurorecorec-674orec674orec-674
    • 2021-02-03
    120 min

    [GVH-186]Boob Lover Shota-kun's Lewd Prank - Mio Kimishima/Honoka Tsujii

  • kimishima mio tsujii honoka censoredbig titsGVHglory questtorindoru tanakaGVH-186GVH18613gvh00186
    • 2021-02-05
    240 min

    [BUR-563]A Naive Beautiful Country Girl's Outdoor Obscene Mischief Video Collection, 4 Hours

  • censoredcreampiebeautiful girlBURgraysburstBUR-563BUR56312bur00563
    • 2021-02-11
    140 min

    [RCTD-381]New: A Watch That Makes Time Stop 21 - Chitose Yuki

  • chitose in the evening censoredbig titssingle workRCTDrocketroute yamazakiRCTD-381RCTD3811rctd00381
    • 2021-02-14
    69 min

    FC2PPV 1685892 [First shot] Adult JD has good sensitivity ♥♥ I gave you plenty of squid with an old man cock ♥♥

  • amateur uncensoredfc2
    • 2021-02-20
    102 min

    [YST-238]I'm Being Subjected To Coercion By The Housewife From Next Door, But Somewhere In My Heart, She's Making Me Happy Yuri Honma

  • really censoredcreampiemature womanYSTkomyoYST-238YST238540yst00238
    • 2021-02-28
    58 min

    FC2PPV 1704935 Yurika 19 years old A beautiful girl job hunting student who looks like an idol! E-cup beauty big breasts in a slender body when you take off your suit! Creampie with seeds on a beautiful girl who is shy and withdrawn!

  • amateur uncensoredfc2
    • 2021-03-05
    91 min

    [SACA-018]A Married Witch's Shaved Pussy!/Mako

  • amateur censoredmarried womanSACAorustak softSACA-018SACA018
    • 2021-03-11
    60 min

    [SIROR-053]Older Women For Rent ~ Her Husband Doesn't Know This Side Of Her No. 53

  • censoredcreampiebig titsSIRORdispatched.comSIROR-053SIROR053h-1492siror00053
    • 2021-04-06
    123 min

    [SDAB-177]Beautiful Young 145cm Girl Gets Her Pussy And Throat Fucked Close Up And Hard By A Large Older Man Ran Sakita

  • sakida run censoredschoolgirlsingle workSDABsod createbacon tanakaone s youthSDAB-177SDAB1771sdab00177
    • 2021-04-18
    202 min

    [XRW-998]Breaking In A Girl By Filling Her Throat Pussy With Cum Consensual Deep Throating Himari Ogawa

  • himari ogawa censoreddeepthroatsingle workXRWreal worksani nakamurareal real worksXRW-998XRW998xrw00998
    • 2021-04-27
    40 min

    FC2PPV 1790087 [No] [Review benefits] The desire of active idols! Blindfold ♡ Blindfold, Ko ☆ Soku, 3P continuous vaginal cum shot breaks reason! ‼ ‼

  • amateur uncensoredfc2
    • 2021-05-01
    108 min

    [ID-031](Ear-Plugged Sex) I Ordered A Female S*****t Delivery Health Call Girl And She Turned Out To Be A Boyish Slut (My Beloved Delivery Health Call Girl) Nanami Ozora

  • sena ai censoredcosplaybeautiful girlIDtmaID-031ID0315526id00031
    • 2021-05-20
    144 min

    [RCTD-401]A Dormitory With Completely Naked Female S*****ts

  • karen anba natsuki kisaragi censoredschoolgirlRCTDrocketscarecrowRCTD-401RCTD4011rctd00401
    • 2021-06-25
    152 min

    [JUFE-300]Big Titty S********l In A Leotard Gets Relentlessly Broken In For 10 Days By The Man Who Lives Across The Hall Momoka Maeda

  • maeda momoko censoredcreampiebig titsJUFEfitchJUFE-300JUFE300jufe00300
    • 2021-07-03
    245 min

    [DSD-830]Blondes Getting it On! 2

  • jesse saint emma starletto censoredanalblowjobDSDmomotaro eizomarchinesweetdevilDSD-830DSD830dsd00830
    • 2021-07-05
    69 min

    493NAEN-066 [Back] Gonzo leaked from a former underground idol! Even if you cry, a fierce piston & a large amount of vaginal cum shot [Bonus 2nd round Gonzo video included Asahi Shizuku

  • amateur censoredamateurbeautiful girlnaennaen-066naen066493naen-066
    • 2021-07-06
    58 min

    C0930 ki210706 Yoshino Sasahara 39years old

  • amateur uncensoredc0930
    • 2021-07-06
    78 min

    345SIMM-651 [NTR] Cuckold A Mysterious Newlywed Wife! A married woman who is excited about the body of a male nude model will forgive even brood parasite seeding … [Memorial nude photo shoot]

  • amateur censoredcreampiebig titssimmsimm-651simm651345simm-651
    • 2021-07-15
    129 min

    [JRZE-062]First Time Filming My Affair. Nagisa Enomoto.

  • nagisa enomoto censoredcreampiemature womanJRZEcenter villageminatoyajurakuJRZE-062JRZE062h-086jrze00062
    • 2021-07-18
    240 min

    [OKAX-755]Currently Looking For Models For A Mature Women's Shoot! Will We Be Able To Fuck Some Tricked Married Women？ NTR Document Video, 4 Hours

  • censoredmature womanOKAXk m producedick mandokuokazuOKAX-755OKAX755okax00755
    • 2021-08-06
    151 min

    [MIAA-488]Busty Slut Delivered Right To Your Doorstep! How About Nasty Creampie SEX Drenched In (Cum, Pussy Juice, Saliva, Sweat, Piss) Until Your Balls Are Drained Dry？

  • censoredbig titsslutMIAAmoodyzminna no kikatanMIAA-488MIAA488miaa00488
    • 2021-08-22
    90 min

    345SIMM-662 J ○ No.1 Beautiful Girl Advent In History! !! Incredibly High Facial Deviation! Fair-Skinned! Beautiful Breasts! Nice Ass! And It’S Lewd Regardless Of Appearance! !! Nanami-Chan, An Impeccable And Perfect Girl, Has An Obscene Relatio

  • amateur censoredcreampieuniformsimmsimm-662simm662345simm-662
    • 2021-08-25
    31 min

    FC2PPV 2071287 [First Shot] 18-Year-Old Active Female ◯ Student, Super Slender Beautiful Girl Rika-Chan!

  • amateur uncensoredfc2
    • 2021-09-09
    125 min

    [RCTD-422]A Step-Mom Guesses Her Step-Son"s Dick When Inserted From Behind! A Risky Step-Mom And Step-Son Challenge

  • censoredmomRCTDrocketkambe tarouRCTD-422RCTD4221rctd00422
    • 2021-09-19
    79 min

    522DHT-0302 Living In Minami Aoyama X 3rd Year Marriage Big Breasts Wife Creampie Her Kana 30 Years Old

  • amateur censoredbig titsmarried womandhtdht-0302dht0302522dht-0302
    • 2021-09-23
    150 min

    [SUN-030]Double Exhibitionist Slut Action A Little Devil Elder Sister Type Is Going On A Reverse Pick Up Exhibitionist Cock Hunt

  • nao mizuki censoredbig titssingle workSUNsuntanaka baconSUN-030SUN03013sun00030
    • 2021-10-09
    241 min

    [UMSO-418]Super Tall! 12 Slender Beauties

  • hikari yoshizawa hikaru konno censoredUMSOk m produceumanamiUMSO-418UMSO418umso00418
    • 2021-10-10
    108 min

    [HSM-033]A Horny Bitch Who Loves To Have Sex! A Half-Japanese Cross-Dressing Gal Alice Takizawa 20 Years Old His/Her Adult Video Debut

  • censoredbig titsamateurHSMhime styleHSM-033HSM03359hsm00033
    • 2021-10-15
    25 min

    FC2PPV 2345223 Immediately After Meeting With A Bizho, 3 Consecutive Blow Jobs In The Mouth (Intense Irama, Treated As An Onaho With A Throat Blow Job ？!) ☆ Intelligent Talented Woman 24 Years Old Arisa

  • amateur uncensoredblowjobfc2
    • 2021-10-22
    123 min

    [HMN-061]34 Years Old, Mother Of Two. Recruited For Serious Sex. Amazingly Naive Wife That Didn"t Even Know What A Dating App Was Is Super Horny For Her Creampie AV Debut! Satsuki Shiki

  • satsuki shiiki censoredcreampiesingle workHMNhonnakarassha miyoshiHMN-061HMN061hmn00061
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-11
    114 min

    [GS-410]Miniskirt Reception Girl Of My Dreams Lovingly Takes My Soaking Dick In Her Mouth. Such A Beauty That My Heart Pounds Every Time I See Her. Such A Precious Flower Who Would Never Normally Turn Her Eye To A Useless Employee Like Me. One Day Wh

  • censoredblowjobGSsosoru garconreddo bo ruGS-410GS4101gs00410
    • 2021-11-16
    138 min

    [TEN-038]Yukemuri NAWA-KOKOKU 1 Rei Kurugi

  • satoshi kuruki censoredbdsmsingle workTENvan associatestenma harutenmaTEN-038TEN038h-859ten00038
    • 2021-11-20
    169 min

    [DGCEMD-090]For Streaming Editions Only! Cums With Bonus Footage* A Big Tits Beauty Who Lives In A Dump Hikari Sena This Lady Engages In Furious Fucking At A Dumpy Home, And Shakes Her Horny H-Cup Titties With A Fury, Cumming Like Crazy, Over And Ove

  • hikari sena censoredcreampiebig titsDGCEMDcelebrity friendsDGCEMD-090DGCEMD090dgcemd00090
    • 2021-11-25
    110 min

    485GCB-018 Erotic! Ayumi Kimino Vs Rider Virgin! !! !! [This Date Course: [Touring! ] Yokosuka Meeting ⇒ Ferry ⇒ Kisarazu ⇒ Night View ⇒ Hotel] Throw The Whole To The Actress! Real Document Gachinko Sex!

  • amateur censoredbig titsamateurgcbgcb-018gcb018485gcb-018
    • 2021-12-16
    487 min

    [CVDX-474]Mature Woman - Fan Thanksgiving Day!! A Cherry Boy, Single Male, And Mature Married Woman Come Together For Center Village productions？ Lewd Fan Service And Raw Fucking All Happen Here In This Paradise Of Pleasure! Enjoy All The Sexual Fun

  • censoredcreampiemarried womanCVDXcenter villageCVDX-474CVDX474h-086cvdx00474
    • 2021-12-26
    63 min

    SIRO-4747 [First Shot] [Enchanted President’s Secretary] [Geki Erotic Rich Blowjob] A Busty Married Woman With A Beautiful Body With A Devilish Sex Appeal And Outstanding Transparency Appears. A Ripe Body Eager For A Sticky And Dense Sex Culmina

  • amateur censoredmarried womanamateursirosiro-4747siro4747siro-4747
    • 2022-01-06
    71 min

    [REBD-614]Mio3 Real And Illusion * Mio Kimijima

  • kimishima mio censoredsingle workREBDrebeccatiger kosakaiREBD-614REBD614h-346rebd00614
    • 2022-01-08
    114 min

    [CMF-068]Female Commando In Siberia - The Spy Who Came From The Cold Country - Seria Aitsuki

  • aitsuki celia censoredbdsmsingle workCMFcinemagicdirty kudoninhuCMF-068CMF068cmf00068
    • 2022-01-21
    129 min

    [HMN-108]Every Scene & Every Bareback Fuck Session Is Filmed Uncut! Love Juices, Cum, And Sweat Swirl Together In Juicy Creampie Sex Akari Mitani

  • mitani akari censoredcreampieblowjobHMNhon nakamon cHMN-108HMN108hmn00108
    • 2022-01-28
    123 min

    [ADN-372]My Neighbor, Who Is Loudly Having Sex Every Night, Seduces Me In Frustration While Her Husband Is Away. I Sweated And Fucked Her For A Week. Iroha Natsume

  • natsume saiharu censoredslutsingle workADNattackersdragon nishikawaotona no dramaADN-372ADN372adn00372
    • 2022-02-04
    120 min

    [DASD-967]Trading Places: Men Who Cum Getting Assfucked By Transexual Cock. Ramu Ichinose

  • ichinose ram censoredslutsingle workDASDdasnao masakiDASD-967DASD967dasd00967



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored