upskirt big tits high vision censored jav




FC2MIDVSHKDCHRVATIDADNABWGMEMNNPJMARACESDFSDSSHMNNACRMVSDDASDPREDWANZAVSAVENXSSNI

2022-02-25
179 min

[MIDV-059]ヤンチャで生意気な幼馴染がニヤニヤ誘惑パンチラで全力アピール チラ見する僕へお尻フリフリ挑発！ムラムラ爆発で濡れ染みジュワァ！ 明日見未来

  • tomorrow s future censoredbig titsschoolgirlMIDVmoodyzgoemonmoodyz divaMIDV-059MIDV059midv00059
    • 2022-02-23
    113 min

    [GS-424]Passionate Sex With The Sexy Office Lady Next-door That Goes To Work Looking Composed And Proper. One Day When I"m Coming Home The Office Lady That Looks Down On Unemployed Losers Like Me Is In My Doorway After Partying Hard, Falling Over

  • censoredbig titsGSsosoru x garcontumblerGS-424GS4241gs00424
    • 2022-01-27
    207 min

    [SW-825]Getting Lewd At A Class Reunion After Seeing A Girl That Was My First Love! She"s A Super Horny Married Woman Now With Huge Tits And Offers Panty Shot Temptation. Fucking At Her Work And Home, All On Record To See!

  • censoredbig titsSWswitchyocchanswitch switchSW-825SW8251sw00825
    • 2022-01-14
    240 min

    [KRU-141]Filmed At A Girls School In Tokyo Tussling And Hustling Erotic Videos A Beautiful Y********l In Uniform Innocently Plays Erotic Games Without Worrying About Being Seen By The Boys 9

  • censoredbig titsbeautiful girlKRUkarumagroupKRU-141KRU141kru00141
    • 2022-01-13
    201 min

    [SW-821]Lewd Education For Older Step-sister. She"s All Grown Up Now With A Curvy Body, And She Gets A Big Lesson From A Hard Dick!

  • censoredbig titssisterSWswitchyocchanswitch switchSW-821SW8211sw00821
    • 2021-12-10
    119 min

    [IPX-777]Momo Sakurazora Is Seduced By Her Boss With Her Lewd Words And Sweaty Pouches.

  • sakura sky momo censoredcreampiebig titsIPXidea pocketzampadishIPX-777IPX777ipx00777
    • 2021-11-11
    104 min

    [GS-411]"Is She Wearing The Naked Apron Outfit!？ A Home Delivery Sexy Big Tits Maid, Fucking Included" My Wife Went Home To Take Care Of Her Parents, And Since I Didn"t Know How To Take Care Of The House, I Hired A Housekeeping Service ..

  • censoredbig titsblowjobGSsosoru garconreddo bo ruGS-411GS4111gs00411
    • 2021-09-03
    157 min

    [WAAA-094]Getting Wasted And Fucking All Night~Tsubomi

  • bud censoredcreampiebig titsWAAAwanz factoryWAAA-094WAAA094waaa00094
    • 2021-08-26
    185 min

    [SW-796]I Was Enjoying Seeing Daily Panty Shot Action From The College Girl Who Lived Next Door, And Perhaps Because She Took Pity On My Loser Ass, She Decided To Show Off Her Panties And Titties To Me! And That Got Her So Excited That Her Pussy Beca

  • censoredbig titsSWswitchraito fuji makotoswitch hibinoSW-796SW7961sw00796
    • 2021-04-09
    145 min

    [SKMJ-158]Slip Your Dick Into This Big Ass Sch**lgirl From Behind For Some Quickie Action! This Beautiful Y********l In Uniform Works Part-Time At A Housecleaning Service And When She Came To Your House You Couldn't Resist The Temptation Of Her M

  • censoredcreampiebig titsSKMJred face girlswing nagaseSKMJ-158SKMJ158h-1324skmj00158
    • 2021-03-26
    118 min

    [CLUB-634]I Fell In Love With A Cheerful Slut And Seduced Her By Pretending I Was A Virgin. She Couldn't Help But Want To Break In A Sweet, Shy Boy Like Me And The Moment My Cock Met Her Big Tits She Fell In Love With My Erection. Part Two.

  • censoredbig titsuniformCLUBhentai shinshi clubCLUB-634CLUB634club00634
    • 2021-03-03
    120 min

    [PFES-014]Pay-For-Play Sex In The Country A Big Tits Babe With Beautiful Skin Will Take Off Her Panties For 500 Yen

  • censoredbig titssquirtingPFESe bodylamb chopsummer panties festivalPFES-014PFES014pfes00014
    • 2021-01-21
    181 min

    [SW-752]Devilish Little Cutie With Big Tits And A Big Booty Awakens Her Inner Slut! Her Lover Turns The Tables On Her And Pounds Her With His Huge Cock!

  • censoredbig titsSWswitchyocchanswitch switchSW-752SW7521sw00752
    • 2020-11-06
    481 min

    [DCX-118]I Can Fuck Her, Right？ Defenseless Women Who Are So Erotic They Go Around Unwittingly Seducing Men - 30 People, 8 Hours

  • censoredbig titsDCXprestigedoc maxDCX-118DCX118118dcx00118
    • 2020-10-14
    62 min

    [NYH-040]My Friend's Older Sister Lured Me To Temptation With Her Colossal Tits And Panty Shot Action Natsuko-san's Titties Natsuko Mishima

  • natsuko mishima censoredbig titssingle workNYHdirectorsmeow meow houseNYH-040NYH0401nyh00040
    • 2020-08-13
    196 min

    [SW-718]Big Stepsister Shotacon! My Dick Is Getting Squeezed By My Big Stepsister's Titties And Her Big Ass And Now My Cock Is Swollen So Big, I Decided To Get Back At Her For Always Bullying Me By Pumping Her Mouth And Her Pussy With Furious Pis

  • censoredbig titsSWswitchyocchanswitch switchSW-718SW7181sw00718
    • 2020-07-20
    57 min

    [AKDL-036](Breast Shot, Panty Shot Voyeur) Estimated B Cup - F Cup Small Tits, Big Tits 8 Girls Godlike Masturbation Video

  • yuuri yurina aizawa censoredbig titsAKDLakinorifsetaknrAKDL-036AKDL0361akdl00036
    • 2020-05-16
    154 min

    [ROYD-009]When I Spent All Night With My Severe And Skinny Big Tits Lady Boss, She Let Me Get An Exclusive Peek At Her True Self, And That Made Me Want Her For Myself. Yu Shinoda

  • shinoda yu censoredbig titssingle workROYDroyalkawajirihhh groupROYD-009ROYD009royd00009
    • 2020-04-28
    117 min

    [EQ-516]Old Ladies! Please Pump My Cock! Mature Woman Ladies Who Lust For Masturbating Men 8

  • censoredcreampiebig titsEQbullittshinobu kamezufetish specialtyEQ-516EQ516h-100eq00516
    • 2020-04-11
    118 min

    [IPX-474]"You Can Cum Inside Me!" My Female Boss Completely Seduced Me With Dirty Talk and Steamy Panty Shots Minori Hatsune

  • hatsune minori censoredcreampiebig titsIPXidea pocketzaku araidishIPX-474IPX474ipx00474
    • 2020-01-09
    180 min

    [SW-677]My Stepmom's Big Tits And My Stepsisters' Perky Asses In Their Miniskirts Are Mine For The Taking! - When My Dad Got Remarried I Suddenly Got A Slutty Stepmom And Two Slutty Stepsisters, And They're Always Tempting Me With Their B

  • censoredbig titssisterSWswitchyocchanSW-677SW6771sw00677
    • 2019-12-10
    261 min

    [EQ-490]When My Dad Got Remarried, I Suddenly Had A New Stepmom (Big Tits), A New Little Stepsister (Tiny Tits), And Now We're Keeping It In The Family With Creampie Sex!？ They're Always Prancing Around Scantily Clad, Looking Sexy, And Flashi

  • censoredcreampiebig titsEQbullittitazuraEQ-490EQ490h-100eq00490
    • 2019-11-30
    227 min

    [HUNTA-686]I'm In A Cramped Bathtub With My Excessively Big Tits Big Stepsister! I Was Getting Fucked For 3 Days And 2 Nights And Now I Was At My Absolute Limit! My Big Stepsister Came To Town To Stay With Me At My Small Apartment...

  • censoredcreampiesisterHUNTAhunterkawajirihhh groupHUNTA-686HUNTA686hunta00686
    • 2019-11-22
    140 min

    [HZGD-132]My Friend's Wife Seduces Me With Her Voluptuous Body And Her Huge Ass - Adulterous Banging With A Massage Therapist - Kanna Shinozaki

  • kina shinozaki censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiHZGD-132HZGD132h-1100hzgd00132
    • 2019-11-21
    213 min

    [SW-668]You Want To See My Tits, Right？ - She Teases Guys By Showing Off Her Panties - She Gets Her Kicks By Showing Her Classmates Her Bra, Her Tits And Her Panties - Yua Takanashi

  • yuu takanashi censoredbig titssingle workSWswitchlight fujimaswitch switchSW-668SW6681sw00668
    • 2019-11-14
    210 min

    [SSNI-618]Total Domain A Voluptuous Thighs In Uniform Peek-A-Boo Show A Bare-Legged Idol In The Ultimate Temptation A Little Devil Beautiful Girl In Knee-High Socks Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-618SSNI618ssni00618
    • 2019-10-18
    171 min

    [DOCP-177]One Day, My Wife Suddenly Demanded A Divorce, And I Became A Single Father, And The Big Tits Housewives From The Neighborhood Took Pity On Me And Started Helping Me Around The House! And When These Luscious Wives Unwittingly Flashed Panty S

  • misono waka hayama natsuna censoredbig titsDOCPprestigedoc premiumDOCP-177DOCP177118docp00177
    • 2019-09-13
    107 min

    [VRTM-452]"Oh My... You Aren't Trying To Lure Me To Temptation, Are You...？" He Was Alone In The House With His Big Brother's Girlfriend, And All She Was Wearing Was A Single Button-Down Shirt, And No Bra Over Her Big Tits! He Could S

  • anne mashiro hamazaki mao censoredcreampiebig titsVRTMv r produceken hosokawaVRTM-452VRTM452h-910vrtm00452
    • 2019-08-22
    150 min

    [SW-650]My Friend's Girlfriend Is A Seductive Slut Who Lets Me See Her In Her Underwear And Puts The Moves On Me. With Her Boyfriend Right Next To Us, She Secretly Puts My Hard Cock Inside Her, Saying "I'm So Turned On Right Now, What Sha

  • censoredbig titsSWswitchyocchanSW-650SW6501sw00650
    • 2019-03-15
    183 min

    [DOCP-135]My Wife Divorced Me Out Of The Blue And Now I'm A Single Father. The Busty Married Ladies In The Neighborhood Took Pity On Me And Started Helping Me Around The House! When They Realized Their Unintentional Downblouse And Panty Shots Wer

  • natsuko mishima tamaki walnut censoredbig titsDOCPprestigedoc premiumDOCP-135DOCP135118docp00135
    • 2019-03-10
    199 min

    [HEZ-016]Free Hugs For Pure Girls! We Get Innocent Girls We Picked Up On The Street To Take Off Their Clothes And Have Sex With Them!

  • censoredbig titsHEZhot entertainmentnetsuyujinnetsuyujinHEZ-016HEZ01659hez00016
    • 2019-03-10
    300 min

    [EQ-444]I'll Pay You To Fuck My Friend's Girlfriend!

  • censoredbig titsamateurEQbullittimpulseEQ-444EQ444h-100eq00444
    • 2019-03-06
    182 min

    [SSNI-424]My Girlfriend's Busty Big Sister Seduces Me With Pantyshots And I'm The Loser Who Gives In To Temptation. Aoi

  • censoredbig titsblowjobSSNIs1 no 1 stylegoemonSSNI-424SSNI424ssni00424
    • 2019-02-16
    178 min

    [SSNI-412]I Want You To Flash Your Panties At Me While Looking At Me With Disdain. Aika Yumeno

  • yumeno aika censoredbig titsschoolgirlSSNIs1 no 1 stylekyoseiSSNI-412SSNI412ssni00412
    • 2018-12-14
    240 min

    [UMSO-223]All You Need Is Courage! Picking Up Working Women Special. Izakaya, Hostess Bar, Karaoke Bar Workers. 12 Women, 4 Hours

  • censoredcreampiebig titsUMSOk m produceumanamiUMSO-223UMSO22384umso00223
    • 2018-12-13
    240 min

    [HUNTA-532]My Big Sister's Busty Friend Tempts Me From The Top Bunk Of The Triple Bunk Bed. My Sexy Stepsister's Friend Is Sexy Too! And They Both Have Big Tits! She Seduces Me Behind My Sister's Back In Our Triple Bunk Bed!？ After Our Pa

  • censoredbig titssisterHUNTAhunterkawajirihhh groupHUNTA-532HUNTA532hunta00532
    • 2018-12-10
    244 min

    [RHE-627]A Horny Volutpuous Mature Woman Who Likes To Secretly Fuck Young Men While Nobody's Looking 12 Ladies/4 Hours

  • censoredbig titsmature womanRHEhot entertainmentRHE-627RHE62759rhe00627
    • 2018-11-22
    114 min

    [FSET-798]When I Looked Between The Legs Of A Hard Working Nurse, I Found A Stain On Her Panties!？ I Couldn't Stop Myself, I Had To Touch Her...The Sensitive Nurse Got Her Pussy Dripping Wet!!

  • aika mirei arisa miyagawa censoredbig titsnurseFSETakinorikyoaknrFSET-798FSET7981fset00798
    • 2018-10-25
    150 min

    [SW-588]Turned On By My Friend's Big Sisters! Knowing That I Visit My Friend Just To Look At Their Tits, They Bring Their Tits Closer To Me! I Couldn't Control Myself Anymore So I Grabbed Her Colossal Tits. She Took Me To A Place Where My Fri

  • censoredbig titsSWswitchyocchanswitch switchSW-588SW5881sw00588
    • 2018-10-25
    143 min

    [SW-590]This Hardworking Adolescent Student Was At The Bookstore When This Married Woman Showed Up And Showed Him Her Tits! At First She Showed HIm Some Erotica To Try To Get His Attention, And Then She Flashed Panty Shot And Titty Shot Action At Him

  • censoredbig titsSWswitchtakeshi yamashiroswitch switchSW-590SW5901sw00590
    • 2018-10-06
    119 min

    [SSNI-316]The Beautiful, Provocative Girl Who Secretly Challenges You With Panty Shots. Miharu Usa

  • miharu hanasaki censoredbig titsbeautiful girlSSNIs1 no 1 styleusa pyonSSNI-316SSNI316ssni00316
    • 2018-06-07
    180 min

    [SW-561]A Horny Big Sister This Big Tits Big Sister Will Press Her Big Ass And Titties Up On You And Say, "I'll Let You Cum Your White Semen All Over Me!" And Rub Herself All Over You, And Then She Assaulted My Underdeveloped But Naughty

  • censoredbig titssisterSWswitchyocchanSW-561SW5611sw00561
    • 2018-03-08
    225 min

    [DANDY-592]"Go Ahead And Jack Off While Staring At My Panties" The Patient In The Hospital Bed Next To Mine Has A Girlfriend Who Keeps Coming Over And Teasing Me With Panty Shot Action Because She's A Horny Slut vol. 1

  • censoredbig titsblowjobDANDYdandygarret hashimotoDANDY-592DANDY5921dandy00592
    • 2018-02-08
    145 min

    [IENE-860]No Matter How Many Times She Cums, This Orgasmic Cherry Boy Won't Stop His Hard Piston Thrusts! His Big Tits Big Sister-In-Law Tries To Escape, But He'll Keep Cumming After Her And Fucking Her Brains Out! "Please Stop! I've

  • censoredbig titssisterIENEienergyie nergyIENE-860IENE8601iene00860
    • 2017-09-22
    199 min

    [SCPX-228]All The Working Girls Here All Have Big Tits! These Sales Ladies Are Flashing Titty Shot And Panty Shot Action To Raise Their Sales Numbers A Big Tits Miniskirt Company With A Horny Temptation Sales Manual

  • censoredcreampiebig titsSCPXk m producekasai kijinSCPX-228SCPX228h-565scpx00228
    • 2017-09-02
    221 min

    [KUNK-068]VTR of Coworkers Getting Carried Away at the Post-Fireworks Festival Drinking Party Misa Yuzu Amateur Used Panty Club

  • censoredbig titsamateurKUNKkunkaKUNK-068KUNK068kunk00068
    • 2017-07-08
    116 min

    [ARM-615]A Perverted Attraction Show - You Can See Girls' Panties at this Fake Storefront 2

  • miyu saito chuncheon serase censoredbig titsschoolgirlARMaroma planningdont knowaromaARM-615ARM615arm00615
    • 2017-06-16
    151 min

    [EKDV-488]Big Tits x Bikini Cheerleader Misato Nonomiya

  • nonomiya misato censoredcreampiebig titsEKDVcrystal eizokumataro morinoe kissEKDV-488EKDV48849ekdv00488
    • 2017-06-15
    118 min

    [SW-492]I Wound Up Sharing A Room With My Hot Coworker On A Business Trip. She Got Drunk, Sloppy, And Her Cleavage Had Me On The Verge Of Busting A Nut. She Noticed And Wrung Out All The Tension Through My Shaft.

  • censoredbig titsSWswitchdragon nishikawaswitch switchSW-492SW4921sw00492
    • 2017-06-09
    136 min

    [TEM-053]My Mom's Little Sister Suddenly Came To My House As A Drunk Girl! When I Played Some Pranks On Her Unguarded Body, She Came At Me With Serious Temptation And Sucked Me Dry Of Every Last Drop Of Semen!

  • asagiri hikari otowa leon censoredbig titsmature womanTEMprestigetemptationTEM-053TEM053118tem00053
    • 2017-05-20
    237 min

    [KUNK-060]Dirty Poo Fills Golf Circle Vacancy. Rio, 19. Pants Stain. Risa's Lesson. Loving Used Pants Amateur Club

  • censoredbig titsamateurKUNKkunkarubber glovesKUNK-060KUNK060kunk00060
    • 2017-05-18
    180 min

    [SW-484]My Friend's Mom Is Giving Me A Horny Sex Education She Lured Me With Her Hot Cleavage And Got My Cock Rock Hard For A Very Adult Lesson In Sex

  • censoredbig titsmature womanSWswitchyocchanswitch switchSW-484SW4841sw00484
    • 2017-04-20
    196 min

    [DANDY-546]My Colleague Is A Married Woman, And When We Both Got Shitfaced Drunk One Night, She Was Sleeping While Exposing Some Panty Shot Action, So I Decided To Masturbate While She Slept, But Then She Caught Me, And Decided To Fuck Me vol. 1

  • censoredbig titsDANDYdandygarret hashimotoDANDY-546DANDY5461dandy00546
    • 2017-04-16
    387 min

    [HUNTA-288]An Ultra Orgasmic Big Tits Lady! I Suddenly Had A New 30 Year Old Stepmom Who Was Young And Had A Great Body! 2 She's Always Prancing Around Scantily Flashing Panty Shot And Titty Shot Action So I'm Rock Hard Every Day! My Stepmom

  • censoredcreampieHUNTAhuntervolvo nakanohhh groupHUNTA-288HUNTA288hunta00288
    • 2017-04-06
    157 min

    [SW-477]I'm Surrounded By Married Woman Babes! When I Enrolled In This School, I Was A Loser With No Experience With The Ladies, But These Horny Housewives Were Hungering For Young Cock And Lured Me To Temptation With Their Bodies, And Now My Dic

  • censoredbig titsmature womanSWswitchtakeshi yamashiroswitch switchSW-477SW4771sw00477
    • 2017-03-18
    119 min

    [SW-474]I Moved To A New Place And The Family Next Door Was Filled With Big Titties, From Their Mom To Her Daughters! They Welcomed My Single Ass To Their Home By Jiggling Their Big Tits And Asking Me To Sexually Service Them It Was A Dream Cum True

  • censoredbig titsmature womanSWswitchSW-474SW4741sw00474



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored