upskirt censored jav high vision school uniform




FC2STARSSDABSANHUNTBAPODAUKGDASDLULUEBODMILKVEMANATRWAAAMIAASQTEAVSAWANZATIDAWDCESD

2019-12-08
127 min

[ARM-822]A Little Devil Temptation By An Intellectual Girl

  • chiharu miyazawa akemi miu censoredslutARMaroma planningkijin kasaiaromaARM-822ARM822arm00822
    • 2019-11-21
    213 min

    [SW-668]You Want To See My Tits, Right？ - She Teases Guys By Showing Off Her Panties - She Gets Her Kicks By Showing Her Classmates Her Bra, Her Tits And Her Panties - Yua Takanashi

  • yuu takanashi censoredbig titssingle workSWswitchlight fujimaswitch switchSW-668SW6681sw00668
    • 2019-11-18
    115 min

    [FGAN-002]My Personal Panty Shot Doll Chiharu Chiharu Miyazawa

  • chiharu miyazawa censoredcreampiesingle workFGANfetish eyesFGAN-002FGAN002h-1440fgan00002
    • 2019-11-18
    130 min

    [FGAN-004]This Beautiful Young Girl's Plump Pussy Makes Me Hard - Mizuki Yayoi

  • mizuki yayoi censoredcreampiebeautiful girlFGANfetish eyesFGAN-004FGAN004h-1440fgan00004
    • 2019-11-09
    120 min

    [MIAA-181]A Little Devil In Black Tights This Beautiful Young Girl In Uniform Kept On Luring Me To Temptation With Her Tight And Beautiful Legs In Silky Smooth Tights As She Guided Me To Ejaculation Mitsuki Nagisa

  • scooping censoredbeautiful girlslutMIAAmoody ssapporo taroeveryone s kikatanMIAA-181MIAA181miaa00181
    • 2019-09-27
    174 min

    [FNEO-039]Attention All Men! Be Cautious Of Girls In The Library! "Shhhh! Be Quiet Or You'll Get In Trouble! But On The Other Hand..." Unable To Resist Her Sexy Temptation In The Library, You're On The Prowl For That Prim And Proper G

  • yuri fukada ai minano censoredcreampieschoolgirlFNEOfirst staryosukefirst star neoFNEO-039FNEO039h-491fneo00039
    • 2019-09-14
    195 min

    [HUNTA-654]"Are You Showing Me Your Panties On Purpose？" There's A High School Girl Working Part-Time At The Bakery Where I Work, And She Keeps Her School Uniform On, Making Her 130 Cute!

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-654HUNTA654hunta00654
    • 2019-09-12
    159 min

    [SW-654]The Beauty Of A Sch**lgirl In A Ponytail, The Nape Of Her Neck, And Her Panty Shot Pleasure I Was Longingly Looking At Her As She Tied Up Her Hair, And She Was Embarrassed To Be Seen Lifting Her Armpit, And That Made My Heart Leap With Excite

  • censoredschoolgirlSWswitchlight fujimaSW-654SW6541sw00654
    • 2019-08-08
    186 min

    [SW-649]Do You Want To See My Panties？ Well Then I'll Show You! My Classmate Akari-san Always Treats Me Like A Kid. But One Day, Calling It A Special Treat, She Lifts Up Her Skirt And Shows Me Her Panties! It's The Best Day Of My Life! - Akar

  • akari neo censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-649SW6491sw00649
    • 2019-08-04
    135 min

    [DVDMS-432][Raw Fucking Sch**lgirl Selfies] She Tempted Her Friend's Big Brother With Panty Shot Action And Got Him Nice And Hard, And Then She Domesticated Him Into Her Obedient Cock So She Could Have Sex Whenever She Wanted

  • censoredcreampieschoolgirlDVDMSdeep shiromichi hoseDVDMS-432DVDMS432dvdms00432
    • 2019-07-13
    206 min

    [HUNTA-627]Unguarded Panty Shot Action! Is She Doing It On Purpose？ 2 I Work Part-Time At A Convenience Store, And This Sch**lgirl Works There While Wearing Her School Uniform, And Since Her Skirt Is So Short, Whenever She Reaches Up High To Get Some

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-627HUNTA627hunta00627
    • 2019-07-13
    235 min

    [GDHH-160]There's A Miracle Happening At This Part-Time School Filled With Former Bad Girls! All The Girls Are Wearing Their School Uniform, But Their Ages Are All Over The Place!! And I'm The Only Boy Here! My School Is A Part-Time School, A

  • risa mochizuki someday hyakuoka censoredGDHHgolden timekorosukehhh groupGDHH-160GDHH160gdhh00160
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-07-11
    220 min

    [SW-642]Every Morning, I Would See This Young Sch**lgirl In Knee-High Socks Showing Off Her Thighs And Flashing Panty Shot Action At Me, And She Was So Cute That She Was Giving Me A Hard On, And Then She Would Blush And Get Mad And Say, "You'

  • scooping censoredsingle workSWswitchlight fujimaswitch switchSW-642SW6421sw00642
    • 2019-06-06
    195 min

    [SW-636]You Like Looking Up Schoolgirl's Skirts, Don't You？ My Adorable Cousins From The Countryside Keep Trying To Seduce Me!

  • censoredSWswitchlight fujimaswitch switchSW-636SW6361sw00636
    • 2019-06-06
    225 min

    [SW-635]The Knee-High Socks And Thighs I See Every Morning. The Panty-Shot Schoolgirl Was So Cute, She Was Giving Me A Boner. "You Dirty Man." She Puffed Her Cheeks And Looked At Me Angrily. But She Quickly Started To Stare At Me With Teary E

  • arimura nozomi censoredsingle workSWswitchlight fujimaswitch switchSW-635SW6351sw00635
    • 2019-05-23
    100 min

    [GS-260]I Was Unexpectedly Turned On By The Sight Of This Sch**lgirl In Her Uniform, Standing At The Bookstore And Browsing In Her Short Skirt, So I Found Myself Peeping Some Panty Shot Action. But Seriously, She Didn't Catch On To Me, So I Went

  • censoredcreampieschoolgirlGSsosoru x garconikebukuro store managerGS-260GS2601gs00260
    • 2019-05-23
    215 min

    [SW-632]If You Wanna See A Schoolgirl's Panties, Give Me Money! My Cute Cousins Come To My Place Every Day And Pester Me For Money In Return For Playing With Me And Helping Me Around The House While Flashing Their Panties! They Said They'd Ne

  • censoredSWswitchlight fujimaswitch switchSW-632SW6321sw00632
    • 2019-05-09
    170 min

    [SW-629]I Love Ma-kun! I Don't Want To Fuck My Childhood Friend! My Childhood Friend Is Secretly Flashing Panty Shot Action At Me And Even Confessed Her Love To Me In My Dreams. And Finally, We Crossed The Line Into Lovey Dovey Sweet Dreams Schoo

  • have censoredblowjobsingle workSWswitchlight fujimaswitch switchSW-629SW6291sw00629
    • 2019-05-09
    120 min

    [GS-259]This Panty Shot Action Must Mean That's 200 Luring Me To Temptation, Right!？ But After All, It's My Sister And Her Friends... But They're All So Cute And Sexy... My Sister And Her Friends Came Over To Play, But My Little Sister Wa

  • censoredGSsosoru x garconona pGS-259GS2591gs00259
    • 2019-04-11
    210 min

    [SW-624]The Sporty Sex Of 3 Energetic Sisters With Short Hair!

  • censoredSWswitchlight fujimaswitch switchSW-624SW6241sw00624
    • 2019-04-11
    180 min

    [SW-623]My Little Sister Has Grown Into A Sweet, Affectionate Girl And She's Strangely Sexy. I Know It's Wrong But I Got Addicted To Fucking Her. Azusa Misaki

  • misaki azusa censoredsistersingle workSWswitchlight fujimaswitch switchSW-623SW6231sw00623
    • 2019-03-20
    99 min

    [ARM-746]Don't Look At My Panties! She Fights Back With More Embarrassment! The Schoolgirl "Leg Scissors" My Face With Her Thighs

  • hinano kanzaka miharu kawada anri mita censoreduniformschoolgirlARMaroma planningaromaARM-746ARM746arm00746
    • 2019-03-07
    200 min

    [SW-618]That Old Man Is Looking At Our Panties! Let's Show Him More!! The Schoolgirls At The Family Restaurant Were So Absorbed In Their Conversation, Their Panties Were Showing. They Seemed Annoyed By My Gaze But They Started Showing Me Their Pa

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-618SW6181sw00618
    • 2019-02-22
    240 min

    [OKAX-477]A Must-See For Panty Shot Enthusiasts! A Massage Parlor Where The Girls Unintentionally Provoke You With Panty Shots. 4 Hours

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-477OKAX47784okax00477
    • 2019-01-27
    139 min

    [FNEO-007]The Vulnerable Schoolgirl With Her Skirt Riding Up, Sitting Nonchalantly In The Passenger's Seat Of A Car In A Parking Lot Was Just Too Cute...

  • censoredcreampieschoolgirlFNEOfirst starfirst star neoFNEO-007FNEO007h-491fneo00007
    • 2019-01-24
    371 min

    [SW-608]SWITCH 8th Anniversary Video My Classmate Is Luring Me To Temptation With Panty Shot Action At School The Girls From My Class Are All Taking Turns Flashing Panty Shot Action Sex At Me And I'm Getting It From Monday Through Friday

  • censoredSWswitchraito fuji makotoSW-608SW6081sw00608
    • 2018-12-29
    182 min

    [SSNI-380]Total Domain: Tempting Glances of Moe Amatsuka's Heavenly, Smooth Thighs

  • angel moe censoredbeautiful girlslutSSNIs1 no 1 stylegoemonSSNI-380SSNI380ssni00380
    • 2018-12-06
    198 min

    [SW-599]My Little Sister And Her Friend Wanted To Become Youtubers And Earn Some Money, So They Were Filming Naughty Videos. But They Ended Up Doing Naughty Experiments With Me That Led To Us Fucking So We're Releasing It As Porn.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-599SW5991sw00599
    • 2018-12-06
    230 min

    [SW-598]"This Will Cheer You Right Up!" My Barely Legal, Saintly Upperclassmen Say While Getting Me To Get It Up. When I Get In Trouble With Teacher, The Girls Help Lift My Spirits... And Help Me Get Lucky!

  • censoredSWswitchlight fujimaswitch switchSW-598SW5981sw00598
    • 2018-11-16
    210 min

    [DOCP-107]My Friend's JK Little Sister Was Smiling Devilishly As She Lured Me To Temptation With Panty Shot Action! She Gave Me A Furious Face Ride With Her Musty Panties And Then She Teased Me With A Horny Hot Dogging Session...

  • yui natsuhara suzu yamai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-107DOCP107118docp00107
    • 2018-11-08
    141 min

    [MIST-235]The Special Service At The Schoolgirl Observation Club 4. Yui Tomita

  • yu tomita censoredschoolgirlsingle workMISTmr michirusaitaMIST-235MIST2351mist00235
    • 2018-11-02
    135 min

    [HODV-21334]Full-Booty Panty Shot Show and the Total Domain Between Micro-Miniskirt and Knee-High Stockings The Tiniest, Cutest Classmate Kanon Momojiri

  • momojiri kanon censoredschoolgirlsingle workHODVh m pbottomsHODV-21334HODV2133441hodv021334
    • 2018-10-25
    143 min

    [FSET-793]I Got Turned On By The New Member Of The Gymnastics Club Whose Pants Show Under Her Leotard 3

  • sea sky flower minori otani censoredFSETakinoriakinoriaknrFSET-793FSET7931fset00793
    • 2018-10-21
    120 min

    [KAWD-946]The Beautiful, Seductive Girl Who Tempts Me By Flashing Her Panties At Me. Ruru Arisu

  • have censoredschoolgirlslutKAWDkawaiigoemonKAWD-946KAWD946kawd00946
    • 2018-10-11
    155 min

    [SW-586]I'm Going To Roast You Like A Pig! A Glaring Delinquent Schoolgirl And Me. But She's Really Cute And She Gets All Sweet When She's Alone. She's Really A Sheep In Wolf's Clothing And She Can't Say No To Pleasure.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-586SW5861sw00586
    • 2018-10-07
    223 min

    [HUNTA-501]This Naive Girl Said That She Was A Slut, So When I Egged Her On, I Was Able To Fuck Her! There's This Bitchy Girl In My Class Who Pretends To Be A Slut But Even A Cherry Boy Like Me Can Tell That She's Not Really A Slut She Kept O

  • censoredschoolgirlHUNTAhuntermorikihhh groupHUNTA-501HUNTA501hunta00501
    • 2018-10-07
    216 min

    [HUNTA-502]I Can't Believe I'm Living Together With My Cousin Who Ran Away From Home？ I'm Not Used To Living Together With A Girl, And Now I Can't Masturbate With Her Around So My Crotch Is About Ready To Explode! But Then... I Live A

  • censoredschoolgirlhandjobHUNTAhuntercognac kaminohhh groupHUNTA-502HUNTA502hunta00502
    • 2018-10-06
    119 min

    [SSNI-316]The Beautiful, Provocative Girl Who Secretly Challenges You With Panty Shots. Miharu Usa

  • miharu hanasaki censoredbig titsbeautiful girlSSNIs1 no 1 styleusa pyonSSNI-316SSNI316ssni00316
    • 2018-10-05
    120 min

    [TWT-025]Girls In Uniform Who Love Masturbation Are Luring You To Panty Shot Dirty Talk Temptation

  • censoredschoolgirllingerieTWTsarutoru video publishertwin tailsTWT-025TWT025h-897twt00025
    • 2018-07-12
    236 min

    [SW-568]My Classmate Is A Wonderful Angel, Because She Came Up To Me, And Flashed Her Panties At Me And Said, Take A Look And Cheer Up! And Sure Enough, My Cock Got Seriously Happy My Teacher Gave Me A Serious Scolding, So The Cutest Girls In School

  • censoredSWswitchraito fuji makotoSW-568SW5681sw00568
    • 2018-05-04
    212 min

    [GDHH-101]I Transferred To This New School Where It Was All About "Ultra Cool Biz!" All The Students And Teachers Are Showing Off Their Bellies! Panty Shot Action Galore! An Ultra Mini Mini Uniform Action With Tits Practically Showing To Get

  • miyu saito the starry sky censoredschoolgirlGDHHgolden timekorosukehhh groupGDHH-101GDHH101gdhh00101
    • 2018-04-26
    234 min

    [SW-553]If You Want To See It So Bad, I'll Show You! Schoolgirls Love Face Sitting. When I Sit On Your Face, It Means I Love You. 2 My Sister And Her Friends Came Over And Were Tempting Me With Panty Shot Action, And When I Kept Staring, They Sta

  • censoredSWswitchraito fuji makotoSW-553SW5531sw00553
    • 2018-02-16
    240 min

    [GDHH-092]No Matter How Old She Gets, My Innocent Childhood Friend Likes To Play Pranks (Wrestling, Gas Pedaling My Balls, etc) On Me, And It Gets Really Rock Hard!!! Before I Knew It, She Was The Most Popular Girl In Class, And I Became A Wallflower

  • censoredschoolgirlGDHHgolden timerobby kunhhh groupGDHH-092GDHH092gdhh00092
    • 2018-02-10
    119 min

    [MIAE-182]Shining Thick Thighs Penetration Slender Knee High Beautiful Girl - Akari Mitani

  • mitani akari censoredsingle workMIAEmoodyzzampamoodyz acidMIAE-182MIAE182miae00182
    • 2017-12-17
    243 min

    [HUNTA-389]Do Girls Drop Their Guard Underneath The Foot Warmer？ It Was Panty Shot Heaven! One Cold Day, My Little Sister Brought Her Friends Over They All Huddled Together In The Foot Warmer Doing Their Homework, And I Decided To Take A Peek. And I

  • censoredschoolgirlsisterHUNTAhunterkawajiriHUNTA-389HUNTA389hunta00389
    • 2017-11-13
    232 min

    [HUNTA-375]When This Horny Slut Joined The Club, All The Female Members Turned Into Sluts Too! The Literary Club Is Filled With Innocent And Proper Boys And Girls And Now A Slut Has Become The Newest Member!! When She Started Seducing The Male Member

  • censoredschoolgirlHUNTAhuntermorikiHUNTA-375HUNTA375hunta00375
    • 2017-09-03
    199 min

    [GDHH-069]My Childhood Friend's Always Coming Over Uninvited To Make Fun of Me! This Time She Finds My Porn and Says It's All Fake, But As She Watches, She Starts to Fidget. I Give Her a Little Poke and She Immediately Reacts？! I Try Going Fo

  • censoredschoolgirlGDHHgolden timekiteretsuGDHH-069GDHH069gdhh00069
    • 2017-07-08
    116 min

    [ARM-615]A Perverted Attraction Show - You Can See Girls' Panties at this Fake Storefront 2

  • miyu saito chuncheon serase censoredbig titsschoolgirlARMaroma planningdont knowaromaARM-615ARM615arm00615
    • 2017-05-26
    173 min

    [SCPX-204]"Do boys really like it when girls flash their panties？" the girls ask me. I don't talk much, which makes me the perfect crash test dummy for the girls in my class that want to try out sexual stuff. They call me a freak and a pe

  • censoredcreampieschoolgirlSCPXscoopkijin kasaimousouzokuSCPX-204SCPX204h-565scpx00204
    • 2017-05-15
    215 min

    [GDHH-056]I Was Watching Some VR AV And It Was So Virtual And Real, It Blew Me Away! And Now I Was Part Of A Scientific Experiment!？ I Was Never Lucky With The Ladies, But Now I Have An Ultra Cute Schoolgirl Little Sister-In-Law! She Was A Prim And P

  • censoredcreampieblowjobGDHHgolden timeGDHH-056GDHH056gdhh00056
    • 2017-03-24
    147 min

    [MDTM-234]Schoolgirl Panty Shot Temptation, Spoiled Pervert Azuki Turns You On When She Shows Off Her Hot Bod

  • azuki censoredcreampieschoolgirlMDTMmedia station96uchu kikakuMDTM-234MDTM23461mdtm00234
    • 2017-02-19
    239 min

    [HUNTA-265]The Bullies Suggested That I Become Invisible, So I Did It And Since Nobody Else Wanted To End Up Like Me, No One Would Ever Talk To Me Anymore Nobody Would Acknowledge My Presence So Whenever I Stood Up From My Seat, Girls Would Sit At My

  • censoredcreampieschoolgirlHUNTAhuntermorikiHUNTA-265HUNTA265hunta00265
    • 2017-02-05
    242 min

    [GDHH-041]My Childhood Friend Is Having An Orgasm With Her Vibrator!？ My Childhood Friend Is Always Barging Into My Room And Making Fun Of Me For Being A Cherry Boy! Finally She Pissed Me Off One Time Too Many, So I Got Revenge By Giving Her The Elec

  • censoredschoolgirlGDHHgolden timebenzo sanhhh groupGDHH-041GDHH041gdhh00041
    • 2017-02-02
    210 min

    [SW-464]Don't Look At Her Panties! When His Little Sister Was Hanging With Her Friends, She Caught Her Big Brother Peeking At Their Panties "I Hate You!" But Then, She Said, "You Only Get To Look At My Panties"

  • censoredschoolgirlsisterSWswitchraito fuji makotoSW-464SW4641sw00464
    • 2017-01-21
    113 min

    [CHIR-020]The Magical Stopwatch! A Patient! A Dental Assistant! All Stopped In Time!？ Make Time Stop! Titty And Pussy Flashing! See What Happens When We Use It On This Doctor... All The Skirt Lifting We Can Handle! All The Peeping Our Hearts Desire!

  • censoredamateurCHIRreddont knowchirarismCHIR-020CHIR020chir00020



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored