upskirt jav censored high vision javcensored




FC2HNDSHKDNATRCHRVSQTESSISGVHWAAAAMBIMEYDMIDVAPODVENUIPXMARAWANZSPRDSSNIATIDHZGD

2022-02-25
179 min

[MIDV-059]ヤンチャで生意気な幼馴染がニヤニヤ誘惑パンチラで全力アピール チラ見する僕へお尻フリフリ挑発！ムラムラ爆発で濡れ染みジュワァ！ 明日見未来

  • tomorrow s future censoredbig titsschoolgirlMIDVmoodyzgoemonmoodyz divaMIDV-059MIDV059midv00059
    • 2022-02-23
    240 min

    [SW-831]"Fucked By My Father-in-law When My Husband Is Unaware!" Accidental Panty Shot Temptation Leads This Seductive Wife To Lure Her Father-in-law In. 15 Performers, 240-Minute Special.

  • censoredSWswitchyocchanswitch switchSW-831SW8311sw00831
    • 2022-02-23
    113 min

    [GS-424]Passionate Sex With The Sexy Office Lady Next-door That Goes To Work Looking Composed And Proper. One Day When I"m Coming Home The Office Lady That Looks Down On Unemployed Losers Like Me Is In My Doorway After Partying Hard, Falling Over

  • censoredbig titsGSsosoru x garcontumblerGS-424GS4241gs00424
    • 2022-02-19
    136 min

    [SCPX-444]I Was Alone With My Friend"s Mother She Must Be Showing Off Her Cleavage And Sexy Ass To Me On Purpose So That I Can Sneak Peeks And I"m Absolutely Certain That She"s Luring Me On! "Your Mama Is A Super Hot Babe!!" The T

  • censoredcreampiemomSCPXscoopmousouzokuSCPX-444SCPX444scpx00444
    • 2022-02-18
    173 min

    [HUNTB-216]When We Started Hearing Sexual Moans Cumming From Next Door, My Masseuse At This Men"s Massage Parlor Started Touching Her Crotch And Feeling Hot ... I Wasn"t Allowed To Touch The Girls At This Men"s Massage Parlor, But When My

  • censoreduniformHUNTBhuntermasanorihhh groupHUNTB-216HUNTB216huntb00216
    • 2022-02-17
    241 min

    [AARM-061]Panties Are Visible From Inside Her Skirt... Is Just Seeing It Enough？ Or Do I Want To Feel Around And Let My Dick Rub Up Close？

  • censoredblowjobhandjobAARMaroma kikakuaromaAARM-061AARM061aarm00061
    • 2022-02-10
    108 min

    [FGAN-058]Just For Me: Hina, A Panty-Shot Doll. Hina Yanai

  • yanai hina censoredcosplaysingle workFGANfetish eyesFGAN-058FGAN058h-1440fgan00058
    • 2022-02-10
    151 min

    [DANDY-799]Unbelievable Encounter With A Lewd Slut After Missing The Last Train Home! Woman With Beautiful Legs Offers Temptation With A Panty Shot While Sitting Across From Me, I Get Hard And Fuck Her Non-stop While Sandwiched Against Each Other.

  • censoredcreampieschoolgirlDANDYdandybacon tanakaDANDY-799DANDY7991dandy00799
    • 2022-02-05
    137 min

    [MMUS-062]Beautiful Little Devils" Temptation - Miiro Nanasaki

  • nanasaki miiro censoredcosplaysingle workMMUSmarrionkijin kasaikcpMMUS-062MMUS062mmus00062
    • 2022-02-01
    120 min

    [BUBB-114]S********l Staircase Fun: 100 Irresistible S********l Thighs SPECIAL!

  • censoreduniformschoolgirlBUBBeitentatsuzo fujidabukatsudoBUBB-114BUBB114436bubb00114
    • 2022-01-28
    149 min

    [MIDV-041]My Younger Sister Is Good At Tempting Men With Panty Shots - Mio Ishikawa

  • ishikawa mio censoredbeautiful girlsisterMIDVmoodyzkyoseimoodyz divaMIDV-041MIDV041midv00041
    • 2022-01-27
    207 min

    [SW-825]Getting Lewd At A Class Reunion After Seeing A Girl That Was My First Love! She"s A Super Horny Married Woman Now With Huge Tits And Offers Panty Shot Temptation. Fucking At Her Work And Home, All On Record To See!

  • censoredbig titsSWswitchyocchanswitch switchSW-825SW8251sw00825
    • 2022-01-27
    176 min

    [SW-826]If You Keep Looking At Me With Such Sexy Eyes, You"re Going To Get Me Excited! The Ladies Who Live Next Door Are Purposely Showing Off Their Stockings, Panties, And Titties At Me! And So, I Buried My Face Into Their Stocking-Clad Crotches

  • censoredSWswitchlight fujimaswitch switchSW-826SW8261sw00826
    • 2022-01-22
    115 min

    [MMUS-061]Beautiful Little Devil Temptation - Mai Hanagari

  • flower hunting censoredschoolgirlslutMMUSmarrionkijin kasaikcpMMUS-061MMUS061mmus00061
    • 2022-01-14
    240 min

    [KRU-141]Filmed At A Girls School In Tokyo Tussling And Hustling Erotic Videos A Beautiful Y********l In Uniform Innocently Plays Erotic Games Without Worrying About Being Seen By The Boys 9

  • censoredbig titsbeautiful girlKRUkarumagroupKRU-141KRU141kru00141
    • 2022-01-13
    201 min

    [SW-821]Lewd Education For Older Step-sister. She"s All Grown Up Now With A Curvy Body, And She Gets A Big Lesson From A Hard Dick!

  • censoredbig titssisterSWswitchyocchanswitch switchSW-821SW8211sw00821
    • 2022-01-13
    95 min

    [AARM-051]My Cock Got So Hard While I Was Looking At Close-up Panty Shots! I Was Just Bursting Out When She Told Me I Could Tough Her Panties!!

  • arimura nozomi rurucha censoredblowjobhandjobAARMaroma planninghamu oujiaromaAARM-051AARM051aarm00051
    • 2022-01-13
    105 min

    [FGAN-056]Rio, My Very Own Panty Shot Doll Rio Nakamura

  • rio nakamura censoredcosplaysingle workFGANfetish eyesFGAN-056FGAN056h-1440fgan00056
    • 2022-01-13
    113 min

    [GS-418]Married Woman Shame An Alluring Young Wife Who Works At A Cafe Is Bashfully Wearing A Miniskirt, Exposing Her Panties, But Instead Of Being Embarrassed, She"s Lustily Showing Off Her Goods! It Appears That She Had Become Dripping Wet, And

  • censoredGSsosoru x garcontumblerGS-418GS4181gs00418
    • 2022-01-13
    117 min

    [GS-419]Getting Hard When My Step-cousin Comes Over To Play Suddenly And Has No Bra On To Cover Up Her Nipples! I Didn"t Know She Was So Mature Now, Her Body Has Gotten So Sexy And I Didn"t Even Know It, She"s Carefree With No Bra On To C

  • censoredGSsosoru x garconred ballGS-419GS4191gs00419
    • 2022-01-08
    134 min

    [CMV-162]Tied Up And Wearing A Mouth Gag In A Densely Inhabited District. They Put A Vibrator In The Girl"s Panties And Left Her Alone.

  • miu susaki ayu kumano censoredbdsmCMVcinemagicmarukatsuvixenCMV-162CMV162cmv00162
    • 2022-01-07
    217 min

    [HUNTB-182]Virgin Father. 18 Years Ago, I Became a Virgin Father. For 18 Years, I"ve been Raising my Best Friend"s C***d Like a Father. I Haven"t Told the Real Father Yet. I was a Virgin Back Then...

  • censoredschoolgirlblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-182HUNTB182huntb00182
    • 2022-01-01
    122 min

    [BUBB-113]Stairway S********l I"d Feel Irresistible If It Was A S********l In A Thong, Ed.

  • censoreduniformschoolgirlBUBBeitentatsuzo fujidabukatsudoBUBB-113BUBB113436bubb00113
    • 2022-01-01
    139 min

    [MMUS-060]Absolute Panty Shot Action! 3 Devilish Beautiful Girl Babes Who Will Give You Nookie While Continuously Tantalizing And Teasing You

  • satsuki mei white peach censoredMMUSmarrionkijin kasaikcpMMUS-060MMUS060mmus00060
    • 2021-12-31
    162 min

    [CAWD-331]I Was Surrounded On All Sides By These 4 Sisters, And They Subjected Me To Some Serious Slut Treatment And Gave Me A Dream-Cum-True Creampie Harem Good Time Ichika Matsumoto Asuka Momose Chiharu Sakurai Sumire Kuramoto

  • ichika matsumoto momose asuka censoredcreampiebeautiful girlCAWDkawaiirakudaCAWD-331CAWD331cawd00331
    • 2021-12-31
    121 min

    [WAAA-134]Rural Technical School With Too Much Free Time And Panty Shot Temptation Every Day, All There Is To Do Is Rummage Around For A Big Dick! Rara Kudo

  • lara kudo censoredcreampieschoolgirlWAAAwanz factorywanzWAAA-134WAAA134waaa00134
    • 2021-12-30
    125 min

    [AARM-048]The Masturbation Cheerleaders! A Sexy Masturbation Support Cheerleader Who Will Give You Instructions On How To Stroke Your Cock

  • kuraki bookmark misaki azusa censoredanalAARMaroma planningmania satoshiaromaAARM-048AARM048aarm00048
    • 2021-12-24
    150 min

    [SSIS-282]My Usually Quiet S*****t Seduces Me With Her Panting With Conviction Only In Front Of Me.

  • kosui jun censoreduniformschoolgirlSSISs1 no 1 styletrendy yamaguchiSSIS-282SSIS282ssis00282
    • 2021-12-24
    224 min

    [HUNTB-164]Delinquent Girls That Hang Out In The Stairway By My Apartment Are Cute And Super Lewd, And I Can"t Help But Stare Over At Them... The Apartment I Moved To Is In A Bad Neighborhood...

  • censoredcreampieblowjobHUNTBhunterkawajirihhh groupHUNTB-164HUNTB164huntb00164
    • 2021-12-24
    184 min

    [HUNTB-171]Glasses x Knee-High Socks x Miniskirt x Thong This Sch**lgirl Is So Excessively Erotic, She"s Giving Me A Full-On Hard On! "I Don"t Know If I Can Make You Feel Good, But I Can Do Some Sexy Things For You ..."

  • censoredschoolgirlHUNTBhuntermorikihhh groupHUNTB-171HUNTB171huntb00171
    • 2021-12-23
    218 min

    [SW-820]Nice Panty Shot From A S********l! Catching Sight Of S********ls In Skirts Every Day When The Breeze Picks Up And Reveals What"s Under Those Skirts, Getting A Sneaky View Of Those Pale Young Thighs And Ample Asses Wrapped In White Panties

  • censoreduniformschoolgirlSWswitchlight fujimaswitch switchSW-820SW8201sw00820
    • 2021-12-10
    234 min

    [HUNTB-157]"Ouch!" Girls Hits Me Down Below By Mistake During An Airsoft Game! "It"s Your Fault I"m Not Hard!" Sorry, What Should I Do？" "Let Me See Your Underwear For Now..."

  • censoredcreampieschoolgirlHUNTBhunterkoichi davidsonhhh groupHUNTB-157HUNTB157huntb00157
    • 2021-12-10
    244 min

    [HUNTB-155]I"m Timid And Can"t Even Say No To My Female Classmate That Wants To Come Over And Watch An AV... Then She Starts Feeling Lewd While Watching The AV And Can"t Stop Feeling Around My Crotch.

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-155HUNTB155huntb00155
    • 2021-12-10
    119 min

    [IPX-777]Momo Sakurazora Is Seduced By Her Boss With Her Lewd Words And Sweaty Pouches.

  • sakura sky momo censoredcreampiebig titsIPXidea pocketzampadishIPX-777IPX777ipx00777
    • 2021-12-09
    115 min

    [AARM-042]Can"t Take Off My Cute Clothes. Stick Dick In With Panties Pulled Down Over Pretty Clothes. Healing Forest Girls Version.

  • chiharu miyazawa hinako mori censoredbeautiful girlAARMaroma kikakuhamu oujiaromaAARM-042AARM042aarm00042
    • 2021-12-09
    117 min

    [FGAN-054]My Private-Use Panty-Glimpse Doll Kanna Shirosaku Kanna

  • kanna shirasaki censoredcosplaysingle workFGANfechi mefetish eyesFGAN-054FGAN054h-1440fgan00054
    • 2021-12-09
    128 min

    [FGAN-053]Club Uniform Girl Cosplay Fetish Video Yua Kawaei Yua

  • kawaei yui censoredschoolgirlsingle workFGANfechi mefetish eyesFGAN-053FGAN053h-1440fgan00053
    • 2021-12-04
    140 min

    [MMUS-059]A Little Devil of a Beautiful Girl Will Turn You On. Yui Amane

  • amane yui censoredschoolgirlsingle workMMUSmarrionkasai kijinkcpMMUS-059MMUS059mmus00059
    • 2021-11-25
    240 min

    [SW-812]Step-daughter Gives A Panty Shot With Her Curvy Ass That"s Just Too Much Temptation! "Tell Me More About The Naughty Things Step-mom Can"t Know About" Fakecest Dream Special - Step-daughter And Step-dad Compilation. That Body

  • censoredSWswitchyocchanswitch switchSW-812SW8121sw00812
    • 2021-11-25
    200 min

    [SW-813]C***dhood Friend With A Knee-high Stocking S********l Outfit Gives A Panty Shot, And I Got To See Her Thighs And Panties! She Has Liked Me For A Long Time It Seems, And Hearing Her Cutely Confess Her Feelings Got My Dick So Hard!

  • censoredschoolgirlSWswitchraito fuji makotoswitch hibinoSW-813SW8131sw00813
    • 2021-11-25
    229 min

    [SW-814]"Thanks For The Extra Option!" Requesting A Maid That Ends Up Offering Lewd Housekeeping Service？! I Hate Cleaning, So I Called Over A Cleaning Service From Before, Then A Cute Girl Shows Up! She Shows Off A Panty Shot Too! Even After

  • censoredSWswitchlight fujimaswitch switchSW-814SW8141sw00814
    • 2021-11-19
    173 min

    [ROYD-074]My Gentle and Cute C***dhood Friend Spoils Me By S******g With Depressed Me. Karen Asahina

  • karen asahina censoredbeautiful girlsingle workROYDroyalmorikihhh groupROYD-074ROYD074royd00074
    • 2021-11-19
    236 min

    [HUNTB-147]"You Saw My Underwear Just Now, Right？" A Perverted Lady Tries To Give Me A Boner With A Suggestive Panty Shot That Has To be On Purpose With The Way She Spreads Her Legs

  • censoredcreampieslutHUNTBhuntermorikihhh groupHUNTB-147HUNTB147huntb00147
    • 2021-11-18
    125 min

    [AARM-036]Thong Pantyhose And Raw Anal Sex That You Can Watch Closely While Shimmying.

  • narumi hirose tsukasa nagano censoredanalAARMaroma kikakusatoshimaniaaromaAARM-036AARM036aarm00036
    • 2021-11-18
    235 min

    [AARM-037]If You"re Going To Get A Clothed Woman To Nub Your Dick, It"s Better To Wear Something With More Cosplay Elements Than Regular Clothes!

  • censoredblowjobcosplayAARMaroma kikakuaromaAARM-037AARM037aarm00037
    • 2021-11-11
    116 min

    [AARM-035]Straddles Your Face With Panties That Are See-Through From Below Provoking You to Jerk Off.

  • blue hamazaki mao censoredsquirtingAARMaroma kikakukasai kijinaromaAARM-035AARM035aarm00035
    • 2021-11-11
    104 min

    [GS-411]"Is She Wearing The Naked Apron Outfit!？ A Home Delivery Sexy Big Tits Maid, Fucking Included" My Wife Went Home To Take Care Of Her Parents, And Since I Didn"t Know How To Take Care Of The House, I Hired A Housekeeping Service ..

  • censoredbig titsblowjobGSsosoru garconreddo bo ruGS-411GS4111gs00411
    • 2021-11-11
    108 min

    [FGAN-052]A Panty Shot Doll Just For Me. Shiori. Shiori Kuraki

  • kuraki bookmark censoredcosplaysingle workFGANfechi mefetish eyesFGAN-052FGAN052h-1440fgan00052
    • 2021-11-11
    198 min

    [SW-809]Black Pantyhose On A Married Woman With A See-thru Panty Shot! Wives From The Neighborhood Have Huge Asses And Curvy Thighs, Getting Guys Hard With Pantyhose Fun As They Rip And Get Soaked From Taking In A Cock Non-stop!

  • censoredSWswitchyocchanswitch hibinoSW-809SW8091sw00809
    • 2021-11-06
    160 min

    [CMV-160]DID Clothed Crotch S&M Bondage Women Who Grin And Bear The Pain Of Bondage 3

  • yukino is it censoredbdsmCMVcinemagicmarukatsuvixenCMV-160CMV160cmv00160
    • 2021-11-05
    184 min

    [HUNTB-139]A Dream Threesome! Step-sister Went Out Partying With Her Female Friend And Missed The Last Train Home, Now They"re At My Apartment Laying In Bed With Me! The Toss And Turn In Bed, Revealing Their Panties And Breasts...

  • censoredcreampieblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-139HUNTB139huntb00139
    • 2021-11-05
    292 min

    [HUNTB-141]I"m The Only Guy At My School And Spring Cleaning Here, It"s A Panty Shot Heaven! A Panty Shot To See Everywhere You Look! 2 - This Was a Girls" School Till I Showed Up Last Year, Now I"m The Only Guy Here!

  • censoredcreampieschoolgirlHUNTBhunterkonnyaku kannohhh groupHUNTB-141HUNTB141huntb00141
    • 2021-11-04
    110 min

    [STSK-004]Peeping on People Next Door Two People 23 School Visits/Rooms 8 Days

  • censoreduniformamateurSTSKshirouto 39STSK-004STSK004h-1605stsk00004
    • 2021-11-04
    150 min

    [SHIND-020]Stalker M"s Train Touching And Home Invasion Records #38 And 39

  • censoredamateurSHINDshinkirousuzuki o maSHIND-020SHIND020h-1560shind00020
    • 2021-10-30
    131 min

    [MMUS-058]A Couple of Exciting Gals Who Are Temptresses. Sarina Momonaga, Himari Kinoshita

  • sarina momonaga himari kinoshita himari hanazawa censoredslutMMUSmarrionkasai kijinkcpMMUS-058MMUS058mmus00058
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored