various occupations high vision jav censored




FC2ABWEBODSSNIMIDVAVSASPRDDASDCHRVGVHWAAAKSBJCAWDPPPDADNNATRIPXSTARSMEYDLULUPRED

2020-10-16
116 min

428SUKE-044 [Reading Mokaba Miss Yarimoku Hot Spring Date] Pakopako SP to catch and lure a slender busty beauty! !! Paipanma ● Ko is over water storage! ？？ Squirting does not stop www It is not full charge yet Naughty creampie charging second round!

  • amateur censoredcreampiebig titssukesuke-044suke044428suke-044
    • 2020-10-27
    85 min

    [NUBI-044]Felt Up On A Crowded Train - Meek College Girl Made Pliable With Some Masterful Fondling

  • censoredcreampieNUBIkalimantannubiaNUBI-044NUBI044h-1112nubi00044
    • 2020-11-13
    51 min

    FC2PPV 1568379 [Personal shooting] The last lust sex before the affair breaks up with her! The relationship between the two who burns indecently, I have vaginal cum shot without thinking ahead! [Appearance]

  • amateur uncensoredfc2
    • 2020-12-01
    158 min

    [C-2597]Secret Diary #013

  • censoredCgogoskoichi takahashigogo s coreC-2597C2597140c02597
    • 2020-12-05
    47 min

    H0930 ki201205 Requested work

  • amateur uncensoredh0930
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    232 min

    [HUNTA-931]"You Need To Peel Back Your Foreskin And Wash It Carefully, Okay？" 3 - My Older Stepsister Always Treats Me Like A K*d, Including Telling Me How To Take Care Of My Dick

  • censoredcreampiebig titsHUNTAhuntermorikihhh groupHUNTA-931HUNTA931hunta00931
    • 2021-01-17
    111 min

    [DDOB-085]Pounded Pussy - Poor Wife Drilled With Dick Miya Tanaka

  • miya tanaka censoredmature womandeepthroatDDOBdogmanormal kimmy auntDDOB-085DDOB085ddob00085
    • 2021-01-18
    55 min

    IDJS-031 Maki

  • amateur censoredcreampieamateuridjsidjs-031idjs031idjs-031
    • 2021-01-30
    149 min

    [MIAA-380]Busty Wife Gets Fucked By Her Husband`s Hated Boss All Over Again Hikari Sena

  • hikari sena censoredcreampiesingle workMIAAmoodyzzaku araieveryone s porn starMIAA-380MIAA380miaa00380
    • 2021-02-18
    120 min

    [SSNI-990]Busty Undercover Investigator Corrupted By A Lab-Grown Aphrodisiac Aika Yumeno

  • yumeno aika censoredbig titssingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-990SSNI990ssni00990
    • 2021-02-19
    94 min

    [sdgn-011]てんちむ(20)

  • amateur censoredcreampiebig titssdgnsdgn-011sdgn011sdgn-011
    • 2021-02-23
    45 min

    FC2PPV 1699005 ★ Amateur appearance ☆ Continuous angry waves 3P orgy ♥ Beauty BODY Chie-san re-advent! ☆ Excited about the first 3P ♥ Belovero W Blow ♥ Fierce! Continuous Iki ♥ Bottomless Libido Continuous Creampie Ejaculation ♥ [Personal Shooting] *

  • amateur uncensoredfc2
    • 2021-03-07
    137 min

    [URKK-037]Every Day, The Perverted Landlord From Next Door Is Fondling My Titties And Fucking My Brains Out Miku Maina

  • maina miku censoredcreampiebig titsURKKunfinishedrolanda familiar breastURKK-037URKK037urkk00037
    • 2021-03-12
    62 min

    FC2PPV 1723625 [Impact] Gonzo video leaked from popular YouTuber! This is definitely that person … The circumstances behind the seal UP [Leaked]

  • amateur uncensoredfc2
    • 2021-03-18
    169 min

    [SSIS-020]Mahina Amane In PLATINUM SOAP

  • amane mahina censoredbig titssingle workSSISs1 no 1 stylegoemonSSIS-020SSIS020ssis00020
    • 2021-04-02
    233 min

    [HEZ-266]Car Sex Challenge! Sumire Niwa / Shion Sato

  • niwa sumire sato white sound censoredmature womanHEZhot entertainmentHEZ-266HEZ26659hez00266
    • 2021-04-29
    65 min

    SIRO-4410 [First shot] [Beautiful buttocks with soft skin] A 19-year-old cafe clerk with beautiful breasts and pure white ass appears. If the sensitivity of teenage smooth soft skin also increases, it will attract the heat .. AV application on the ne

  • amateur censoredamateursirosiro-4410siro4410siro-4410
    • 2021-05-01
    150 min

    [SHKD-942]Cut Up And Ravaged! Beautiful Office Worker Targeted By The Scissor Man Miki Maeshima

  • miki maejima censoredsingle workSHKDattackerskazumasharkSHKD-942SHKD942shkd00942
    • 2021-05-07
    120 min

    [MIDE-926]The Office Playboy Walked My Busty Girlfriend To Her Car And Now She's Not At Work Today... Nozomi Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyzsuisei akaimoodyz divaMIDE-926MIDE926mide00926
    • 2021-05-21
    72 min

    FC2PPV 1829435 An 18-year-old beautiful girl who works at her parents’ flower shop. She doesn’t know the dirt yet She enjoys a naive body with whitening breasts. Her face is dyed with a large amount of semen and she is baptized for the firs

  • amateur uncensoredfc2
    • 2021-05-28
    171 min

    [SAIT-024]Automatic Sex Doll Violet X Pussy And Anal - Skewered In All Three Holes X 10 Consecutive Loads Of Bukkake Karina

  • censoredanalcosplaySAITtmacosplay kinbaku clubSAIT-024SAIT02455sait00024
    • 2021-07-03
    104 min

    FC2PPV 1899973 [No individual shooting, shocking gravure Gcup beauty leaked a video that is too dangerous with the president’s secretary, NTR, Gachi] The beautiful president’s secretary and mistress of the company that got rid of sala was c

  • amateur uncensoredfc2
    • 2021-07-08
    108 min

    [FGAN-044]Private Use Panty Shot Doll Hono

  • censoredcosplayFGANfechi mefetish eyesFGAN-044FGAN044h-1440fgan00044
    • 2021-07-14
    164 min

    [PPPD-942]Uned At-Home Sex Until Daybreak! Naked Lust And Passionate SEX With World-Class Porn Star Hitomi Hitomi

  • hitomi censoredcreampiesingle workPPPDoppaiPPPD-942PPPD942pppd00942
    • 2021-07-18
    61 min

    Caribbeancom 071821-001 The day I am hornier than ever Emi Sakurai

  • emi sakurai uncensoredcreampiehandjobcaribbeancom
    • 2021-07-22
    484 min

    [FCDSS-010]Yume Nikaido Her FALENO Debut 1-Year Anniversary Complete First Best Hits Collection 8 Hours

  • nikaido yume censoredbig titsbeautiful girlFCDSSfalenofaleno starFCDSS-010FCDSS0101fcdss00010
    • 2021-07-23
    91 min

    [sqb-111]ゆきの

  • amateur censoredbig titsamateursqbsqb-111sqb111sqb-111
    • 2021-07-24
    47 min

    H4610 ki210725 Kayoko Yuge 31years old

  • amateur uncensoredh4610
    • 2021-08-06
    120 min

    [IPX-714]My Slut Teacher Messed With My Cherry Boy Cock, And I Could Never Ever Forget The Experience ... Minami Aizawa

  • minami aizawa censoredblowjobslutIPXidea pockettissueIPX-714IPX714ipx00714
    • 2021-08-21
    120 min

    [JSOP-005]The New Lovely Cougar Bathhouse Series: High Class Sultry Soapland, Starring Michiko Uchihara

  • michiko uchihara censoredmature womansingle workJSOPglobal media entertainmentnakano yayoijukujo soupJSOP-005JSOP005jsop00005
    • 2021-08-31
    39 min

    [521MGFX-020]優木いおりのファンの自宅突撃訪問

  • amateur censoredbig titsamateurmgfxmgfx-020mgfx020521mgfx-020
    • 2021-09-25
    118 min

    [NSFS-027]THE Japanese Girls 10: Wives Getting Fucked By A Crazy Guy - Kanade Tsuchiya

  • kana tsuchiya censoredsingle workdramaNSFSnagae styletomitake taroNSFS-027NSFS027nsfs00027
    • 2021-10-01
    61 min

    SIRO-4648 [First Shot] [Pure Beautiful Girl] [Sensitive Constitution] Discovered An Active University Student With An Impressive Smile On Her Purely Shining Eyes. The Petite And Delicate Body Reacts Excessively With A Light Touch, And The Innocent Sm

  • amateur censoredamateursirosiro-4648siro4648siro-4648
    • 2021-10-07
    160 min

    [MIST-351]Ass Hell Level 2 Natsuko Kayama

  • natsuko kayama censoredmature womanslutMISTmr michirurassha miyoshiMIST-351MIST3511mist00351
    • 2021-10-10
    87 min

    345SIMM-669 [Uncle All Drink J ○] A Serious Student Council President At School! Nacchan, A Nympho School Girl Who Cums Herself For Semen When She’S Alone With Her Uncle W I Met Nacchan Who Is Busy Preparing For The School Festival After A Long

  • amateur censoredcreampiesquirtingsimmsimm-669simm669345simm-669
    • 2021-10-15
    105 min

    [VEC-499]A Secret Between Me And My Friend"s Mother. Forcibly Had Creampie Sex With Her... Miyu Tsubakihara

  • miyu tsubakihara censoredcreampiemature womanVECvenussarumegami venusVEC-499VEC499vec00499
    • 2021-10-23
    40 min

    H0930 ki211024 Ryoko Kawamura 29years old

  • amateur uncensoredh0930
    • 2021-10-30
    177 min

    [SORA-343]Exposing Submissive Miss Saseko. Hikari Chan (20 Years Old)

  • censoredcreampiebig titsSORAyama to sorahimurokkuSORA-343SORA343sora00343
    • 2021-11-27
    59 min

    519MAZOF-026 [Libido In The Second Growth Period! ] Public JK [Impact Video] Examination Student, Dohamari In Sex With Smadra, Ascending To White Eyes With Convulsive Acme That Does Not Stop Real Masochist Female Cum Shot Sexual Intercourse [Outflow]

  • amateur censoredcreampieuniformmazofmazof-026mazof026519mazof-026
    • 2021-12-01
    138 min

    [DROP-068]Sticky Cum Facial Fluids!! These Amateur Girls Are Getting Their First Dark Dildo Masturbation Pleasure 4

  • censoredamateurDROPoffice k sdrop office ksDROP-068DROP06836drop00068
    • 2021-12-24
    124 min

    406FTHT-032 [Master-Slave Relationship! Order! Discipline! Punishment! Reward! Trust Relationship! Loyalty! Be Careful Of Riva In The Dom Sub Universe! ] An Electromagnetic Wave Girl Who Always Has An Erotic Antenna! The Growth Of Glossy Brain Cells

  • amateur censoredcreampieamateurfthtftht-032ftht032406ftht-032
    • 2022-01-07
    145 min

    [RKI-621]The New Bucketloads Of Bukkake. Nanami Kawakami

  • kawakami nanami censoredcreampieslutRKIrookiezampaRKI-621RKI621rki00621
    • 2022-01-20
    28 min

    FC2PPV 2608319 Until Sunday! !! "# 23" A Local Cat Cafe Clerk. Massive Vaginal Cum Shot With A Sense Of Immorality That Commits A Young Child Arbitrarily ♡ Small Animal Feeling ♡

  • amateur uncensoredfc2
    • 2022-01-29
    92 min

    [SLAP-106]KAIDAN 11

  • censoredschoolgirlSLAPdigital arkdigital ark dejitarua kuSLAP-106SLAP106slap00106
    • 2022-02-05
    239 min

    [CADV-840]My Wonderful Girlfriend - Waka Misono

  • misono waka censoredcreampiebig titsCADVcrystal eizocrystal exCADV-840CADV840cadv00840
    • 2022-02-05
    144 min

    [DVAJ-557]After Flirting With A Woman That Married Late During Her 30s, We Were Just Going To Fuck Once And End It, But She Ends Up Locking Her Legs Around Me While She Holds Me Down To Fuck Hard Over And Over For Non-stop Creampie Loads. Nanami Kawa

  • kawakami nanami censoredmature womanslutDVAJalice japannao masakiDVAJ-557DVAJ557dvaj00557
    • 2022-02-10
    200 min

    [NHDTB-631]"Put Your Dick In My Ass And Pussy Too..." An Anal Remote Vibrator Gets Inserted For Long-distance Asshole Orgasms! Anal Stimulation That Makes Their Lower Body Twitch In Pleasure As These Sports Girls Plead To Get Fucked In Both O

  • censoredNHDTBnatural highxylonocaineNHDTB-631NHDTB6311nhdtb00631
    • 2022-02-12
    111 min

    [BBTU-031]Titty-Fuck Big Boobs Masochist Club Fuckathon: With Leona Tomiyasu

  • takehiro tomiyasu censoredcreampiebig titsBBTUdogmatenunmy big titsBBTU-031BBTU031bbtu00031
    • 2022-02-17
    41 min

    [508HYK-045]イケイケお姉さん 45 わか 長い舌を持つ妖艶美女が密着ソープで精子搾り取り

  • amateur censoredbig titsamateurhykhyk-045hyk045508hyk-045
    • 2022-02-18
    116 min

    [JUL-866]Awakening Of A Magical Woman Who Unknowingly Makes Younger Men Fall In Love With Her: Sweat, Spit, Love Juices, Passionate Kissing Sex Where All The Liquids Come Together - Haruka Okumi

  • okumiharu censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-866JUL866jul00866
    • 2022-02-26
    62 min

    FC2PPV 2683196 Genuine Active Active Major Ca Advent! First Shot With A Translation Of A Former Beauty Pageant SSS Class Beauty! Outstanding Style! Excellent Sensitivity! I Can’t Stand The Expression Of Rushing To Vaginal Cum Shot Secretly By Se

  • amateur uncensoredfc2
    • 2022-03-05
    36 min

    210AKO-456 MAKINA (Tamaki Nakaoka)

  • amateur censoredamateurakoako-456ako456210ako-456
    • 2022-03-11
    180 min

    [PPPE-015]Can I Come Over From Now On？ Super Horny Guy That Loves Big Tits Gets A Crazy Home Delivery! Hitomi Will Give A Full-on Titty Fuck For 5 Minutes, And If You Last She"ll Offer Raw Creampie Sex!

  • hitomi censoredcreampiebig titsPPPEoppaiPPPE-015PPPE015pppe00015
    • 2022-03-22
    44 min

    FC2PPV 2745512 [Limited Time 12000 → 9980] [Sequel] [First Facial Cumshot] 18 Years Old Innocent F Cup Beautiful Girl Mika-Chan! Develop A Young Body And Squirt For The First Time! I Made A Vaginal Cum Shot In Uniform And Shot A Large Amount Of Facia

  • amateur uncensoredfc2
    • 2022-03-24
    124 min

    GS-429 Spiraling Into Sex With A Youthful Girl! Lewd Older Guy That Pays To Date Her! Sexy Younger Girl And An Older Guy That Pays Her End Up Fucking For A Creampie Load! It Feels So Good That He Splurges On Her With Money, Leading Her To Invite Her

  • censoredcreampieGSsosoru x garconred ballGS-429GS4291gs00429



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored