voyeur jav various worker creampie javcensored




FC2DASDROYDRBDAPODATIDNACXGVHAWDVEMASQTEGMEMNACRFSDSSNATRSHKDMIDEBBANMEYDHODVJUL

2020-10-29
134 min

[JRZE-003]50-Something Wife Izumi Tabuchi's Debut Document

  • izumi tabuchi censoredcreampiemarried womanJRZEcenter villagejiro fukagawajurakuJRZE-003JRZE003h-086jrze00003
    • 2020-11-12
    125 min

    [FSDSS-123]Excited Squirting * And Peeing (Heart) Intercourse * Mayoi Arisaka

  • arisaka mayoi censoredbig titssquirtingFSDSSfalenocaptain eharafaleno starFSDSS-123FSDSS1231fsdss00123
    • 2020-11-13
    102 min

    [NSPS-942]Bride's Pussy Face 2 Touka Rinne

  • roaring sound censoredmature womansingle workNSPSnagae stylenagaeNSPS-942NSPS942nsps00942
    • 2020-11-13
    27 min

    [CLO-095]I Want To D***k Your Cum Riona Minami

  • rina minami censoredblowjobbeautiful girlCLOchobitchchovicCLO-095CLO095h-1435clo00095
    • 2020-12-01
    62 min

    345SIMM-564 Small Breasts OL And Big Cock Boss Takeaway Home Sex

  • amateur censoredcreampieamateursimmsimm-564simm564345simm-564
    • 2020-12-05
    146 min

    [SSNI-932]Horny Massage Parlor Hottie Busts My Nut. Shion Yumi

  • evening beauty censoredbig titssingle workSSNIs1 no 1 stylenao masakiSSNI-932SSNI932ssni00932
    • 2020-12-10
    58 min

    230OREC-653 Miwa

  • amateur censoredcreampieamateurorecorec-653orec653orec-653
    • 2020-12-10
    239 min

    [FZR-077]"My Husband's Cock Doesn't Satisfy Me..." The Slut Hall Of Fame! Horny Monster Nymphos: Totally Naughty Wives! File 002

  • censoredcreampiemarried womanFZRpacotterFZR-077FZR0773fzr00077
    • 2020-12-24
    19 min

    HEYZO 2422 Aya’s Amazing Hand Job – Aya Eikura

  • aya eikura uncensoredhandjobheyzo
    • 2020-12-27
    120 min

    [NKD-267]Breaking In Request - Yua Makura

  • yu asakura censoredbig titsbdsmNKDnakajima kogyofubuki sakuraNKD-267NKD267nkd00267
    • 2021-01-03
    41 min

    396BIG-094 Wan

  • amateur censoredcreampieamateurbigbig-094big094396big-094
    • 2021-01-12
    100 min

    [HONB-203]A Lovely, Sexy Gal Who Lets Me Do Her Every Time She Stops By My House To Make A Delivery

  • censoredbig titsamateurHONBmercurythe first shibuya special f e headquarHONB-203HONB203h-1133honb00203
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-15
    134 min

    [ZMEN-076]This Female Teacher's Desperate For A Dicking - Her S*****ts Put A Vibrator In Her Pantyhose And She Just Can't Cum 2

  • hill erina miho tsuno censoredbig titsZMENz mengoro koenjiZMEN-076ZMEN076h-1371zmen00076
    • 2021-01-15
    20 min

    FC2PPV 1645697 [Amateur] 1 experienced person! E-Cup fair-skinned female college student who just graduated from virginity died sex [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-20
    22 min

    FC2PPV 1652349 [Personal shooting] Affair with a young slender married woman. Insert the underwear from the side of the pants and make vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-01-29
    245 min

    [SKMJ-144]"Would You Peel Back The Foreskin Of This Uncircumcised Cherry Boy And Wash His Cock!？" An Amateur Housewife Is Holding This Cherry Boy Tight And Bathing With Him! She's Pouring Out All of Her Maternal Instinct To Wash His Cock!

  • censoredbig titsamateurSKMJred face girlone topSKMJ-144SKMJ144h-1324skmj00144
    • 2021-02-04
    19 min

    HEYZO 2452 Sara’s Amazing Footjob – Sara Ichikawa

  • sara ichikawa uncensoredheyzo
    • 2021-02-22
    111 min

    [AVSA-158]美少女串刺し輪● 憧れのあの娘が汁まみれで犯●れ続けた。初恋の相手・いちかが輩にオモチャにされるのを覗いて鬱勃起 松本いちか

  • ichika matsumoto censoredsingle workAVSAavshiroyuki kimuraavscollectorAVSA-158AVSA158avsa00158
    • 2021-03-13
    62 min

    SIRO-4456 [First shot] [Beautiful receptionist with a gap] [With sincere service ..] Takamine’s flower standing at the reception is panting indecently and she feels too much and she begs for ejaculation with teary eyes .. On the net AV applicati

  • amateur censoredamateursirosiro-4456siro4456siro-4456
    • 2021-03-19
    119 min

    [BKD-259]Stepmother/Stepson Fucking (The Black Forest Road) Ayaka Muto

  • ayaka muto censoredmature womansingle workBKDrubykoji tsujitobijiBKD-259BKD259bkd00259
    • 2021-03-19
    102 min

    [OMHD-005]Cursed Sex Doll Is Possessed With A Devilish Lust Ichika Matsumoto

  • ichika matsumoto censoredblowjobsingle workOMHDdogmamigiwa otaOMHD-005OMHD005omhd00005
    • 2021-03-21
    78 min

    345SIMM-623 A cheerful little J ○ and a nasty day! Hotein from noon → Sperm drinking blowjob & mass cum shot SEX! I thought I was going to bed on that day, but I crawled my uncle at night with the erotic shrine maiden costume that I brought with m

  • amateur censoredcreampieuniformsimmsimm-623simm623345simm-623
    • 2021-04-02
    82 min

    [ADN-307]I Don't Want To Betray Your Father Anymore ... The Dilemma Of A Wife Who Kept On Getting Fucked By Her Stepson. Nanao Nakano

  • nanao nakano censoredsingle workADNattackerskazuki kuryuotona no dramaADN-307ADN307adn00307
    • 2021-04-09
    166 min

    [MKMP-390]First Time Being Fucked Raw Three Times Getting Her Pussy Filled With Thick Cum Nako Hoshi

  • nako hoshi censoredcreampiebeautiful girlMKMPk m producezaku araimillionMKMP-390MKMP390mkmp00390
    • 2021-04-20
    88 min

    [KIR-032]Little Stepsister For Rent "She Can Visit Your Home, No Touching" Haru Yamaguchi

  • yoko yamaguchi censoredcreampieblowjobKIRstar paradisekirei star paradiseKIR-032KIR032h-254kir00032
    • 2021-04-23
    238 min

    [BMW-232]My Stepsister Seduced Me While Our Parents Weren't Paying Attention - Pulse-Pounding Creampie BEST Collection

  • mitani akari real village henan censoredcreampieblowjobBMWwanz factorywanzBMW-232BMW232bmw00232
    • 2021-05-11
    75 min

    326URF-060 [Back customs] [Four consecutive shots of angry waves] [Tide Iki] Good luck! Good tech! Ma ● Ko is good! A neat and clean slender girl with short black hair! A man’s desire for control increases in the gap where a little cheeky attitu

  • amateur censoredcreampiesquirtingurfurf-060urf060326urf-060
    • 2021-05-14
    73 min

    FC2PPV 1811060 ＃ 61 Miu, a beautiful busty girl in a yukata, screams and cums inside Gokkun [Personal shooting] [Gonzo] [High image quality]

  • amateur uncensoredfc2
    • 2021-05-28
    62 min

    FC2PPV 1841311 [No / individual] God-friendly !？ SEX with a cute girl who looks like Haruka Shimazaki! An angelic bitch who gives a blow job and vaginal cum shot with a smile even though she has a virgin face! !! * There is an appearance review privi

  • amateur uncensoredfc2
    • 2021-06-04
    160 min

    [PRED-315]Super Slut Harem Beautiful Women Surrounded Me And Made Me Cum Inside Of Them Over And Over! Ai Hoshina Kurea Hasumi Hibiki Otsuki AIKA

  • sena ai hasumi claire censoredcreampieslutPREDpremiumtrendy yamaguchielegancePRED-315PRED315pred00315
    • 2021-06-16
    118 min

    [SSIS-092]Furious Pounded From A Huge Dick Drives Pussies Insane With Ecstasy - Intense Vaginal Orgasm Creampie SEX Ichika Hoshimiya

  • ichika hoshimiya censoredsquirtingsingle workSSISs1 no 1 styleichigoharaSSIS-092SSIS092ssis00092
    • 2021-07-01
    242 min

    [NACX-082]Big-Titted Mature Women's Creampies: 20 People, The BEST

  • shiho terashima erica kitagawa censoredcreampiebig titsNACXplanet plusnanakuruNACX-082NACX082h-237nacx00082
    • 2021-07-02
    62 min

    230OREC-810 Kokone

  • amateur censoredcreampieamateurorecorec-810orec810230orec-810
    • 2021-07-04
    87 min

    525DHT-0117 Frustrated Newlyweds Get Creampie Immediately In Street Nampa Aya-san 26 Years Old

  • amateur censoredcreampiemarried womandhtdht-0117dht0117525dht-0117
    • 2021-07-22
    242 min

    [NHDTB-557]My Boss' Daughter Pisses Me Off, So I Gave Her Several Days Of Asshole Breaking In Training Until She Begged Me, "Cum Inside My Asshole" And I Obliged Her With Anal Creampie Sex 2

  • censoredcreampieNHDTBnatural highkansukeNHDTB-557NHDTB5571nhdtb00557
    • 2021-08-14
    133 min

    [SOAN-064]Ticking Time Bomb Anal Sex "So Cute, It"s Sick ..." My Favorite Style Is Sick ... I Love Anal Sex So Much I"m Losing My Mind (We"re Flying In Rare Air Here) Honoka Shiina

  • shiina honoka censoredanalsingle workSOANyama to soratanizoko fu taroukoumon houmonSOAN-064SOAN064soan00064
    • 2021-08-29
    31 min

    481SACZ-056 Minami 4

  • amateur censoredamateurlesbiansaczsacz-056sacz056481sacz-056
    • 2021-09-17
    82 min

    FC2PPV 2212716 J-Cup-Chan And Kan * Re Kaohsiung ♪ In Bright Red Echii Underwear-Ecchi Edition- [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-09-18
    65 min

    C0930 ki210919 Norika Shimokawa 21years Old

  • amateur uncensoredc0930
    • 2021-09-23
    66 min

    200GANA-2564 Seriously Nampa, First Shot. 1694 Capture A Cute College Student Who Shoots Videos For Sns With Clothes That Emphasize Big Breasts! Play With The Boastful Breasts, And Do It! ● Poco Insertion Www Pay Attention To The H Cup God Milk That

  • amateur censoredbig titsamateurganagana-2564gana2564200gana-2564
    • 2021-10-01
    122 min

    [MILK-123]Quickie, Raw Fucking, Creampie, It"s All Allowed! This Super Slutty Gal Will Happily Give Anything A Try! This Call Girl Knows How To Keep Things A Secret When Fucking! Riria Hyodo

  • riria hido censoredcreampiebeautiful girlMILKmilkMILK-123MILK123h-1240milk00123
    • 2021-10-15
    120 min

    [BLK-528]Sex With You After School. A Slut S*****t Gal Takes Magic Chems For Hot Fucking! A Night Of Incredibly Lewd Euphoric Sex. Mitsuki Nagisa

  • scooping censoredcreampieschoolgirlBLKkira kirakira hosi kira black galBLK-528BLK528blk00528
    • 2021-11-01
    122 min

    [GOJU-190]"My Husband Won"t Look At Me As A Woman." A Wife With Colossal Tits Pleads To Appear In Porn Out Of A Desire To Still Indulge As A Woman Ms. Chiaki Age 48

  • censoredbig titsamateurGOJUisojinGOJU-190GOJU190h-1165goju00190
    • 2021-11-18
    105 min

    [XMOM-037]A Voluptuous Lively And Gorgeous Married Woman Sex That Feels So Good This Captivating Married Women Will Cry Chisato Shoda

  • shota chisato censoredmarried womanmature womanXMOMcenter villagesky cloudspink breathXMOM-037XMOM037h-086xmom00037
    • 2021-11-25
    40 min

    H4610 ki211125 Saki Shimada 24years old

  • amateur uncensoredh4610
    • 2021-12-23
    85 min

    [HIMA-097]My Beloved Stepmom Got Remarried Chisato Shoda

  • shota chisato censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-097HIMA097h-086hima00097
    • 2021-12-25
    69 min

    C0930 tk0049 Hiroko Hayashizaki 30years Old

  • amateur uncensoredc0930
    • 2021-12-31
    119 min

    [ATID-491]Anal Tutor Usui Ren

  • usui ren censoredsingle workATIDattackerseitaro hagaein madATID-491ATID491atid00491
    • 2022-01-13
    83 min

    413INST-200 [Leaked] Gcup Active Gravure Idol (25) Cosplay Gonzo At A Hotel Secret Meeting With A Cameraman [Handling Precautions] (Mary Tachibana)

  • amateur censoredcreampiebig titsinstinst-200inst200413inst-200
    • 2022-01-15
    98 min

    [BBTU-029]Bombshell! Looking Down Her Shirt - Nene Tanaka

  • nene tanaka censoredbig titscosplayBBTUdogmatenunore no boinBBTU-029BBTU029bbtu00029
    • 2022-01-19
    40 min

    279UTSU-526 Aina

  • amateur censoredcreampiebig titsutsuutsu-526utsu526279utsu-526
    • 2022-01-27
    244 min

    [SUN-044]Exhibitionist Date Where A Cum-D***king Beauty Is D***king Her First Sperm Of Autumn With Teary Eyes

  • censoredblowjobSUNsunbacon tanakaSUN-044SUN0441sun00044
    • 2022-01-28
    147 min

    [NNPJ-498]Incredible W Eros! Super Popular! Tokyo"s NO.1 Famous Deli Girls Will Appear Together In An AV! The Two Of Them Together Have 70,000 Followers! Yuzu Koh And Ryo Tsubaki

  • emperor yuzu ryo tsubaki censoredcreampiebig titsNNPJnanpa japanNNPJ-498NNPJ498nnpj00498
    • 2022-01-29
    121 min

    [BKD-277]Stepmother And Offspring Sex. [West Otawara Road] Nanao Nakano.

  • nanao nakano censoredcreampiemature womanBKDrubytsuji koujitabijiBKD-277BKD277bkd00277
    • 2022-02-04
    130 min

    [HODV-21647]I Eloped With My Best Friend"s Girlfriend In An RV Over The Weekend, And I Descended Into The Pleasure Of The Greatest, Deepest And Richest Creampie Sex I"ve Ever Had. Yuri Fukada

  • yuri fukada censoredcreampiebig titsHODVh m pbottomsHODV-21647HODV216475642hodv21647



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored