woma high visio censored amateur




FC2IPXMIDESHKDCAWDVEMAATIDDTTNACRNNPJSTARSMVSDHDKAKBIWAAAAPODDASDWANZABWSSNIBBAN

2020-10-29
59 min

Pacopacomama 102920_377 Saki Hanashiro

  • saki hanashiro uncensoredcreampiebig titspacopacomama
    • 2020-11-06
    112 min

    [MKD-218]She Has Clear, Translucent Skin And Is Bursting With Beautiful Luminescence, But She Moans Like A Barely Legal Babe, And Has Such Beautiful Tits, The Contrast Is So Alluring With This Exquisite Fifty-Something Wife As She Makes Her Adult Vid

  • hazuki kashiwagi censoredmature womansingle workMKDrubymaterukazu umiyamaMKD-218MKD218mkd00218
    • 2020-11-06
    146 min

    [NDRA-081]A Wife Becomes Her Neighbor's Mistress #30 Ai Mukai

  • ai mukai censoredbig titsmature womanNDRAjet eizomanji groupNDRA-081NDRA081ndra00081
    • 2020-11-08
    73 min

    AVHD-101 Erika

  • amateur censoredamateurblowjobavhdavhd-101avhd101avhd-101
    • 2020-11-13
    54 min

    FC2PPV 1568229 Erotic Gal Yukopi ⑭ and Drive Ona Exposed Walk Karaoke F Benefits 54 Minutes + 35 Minutes

  • amateur uncensoredfc2
    • 2020-11-19
    120 min

    [JYMA-004]She's Got Her Husband's Permission To Star In Porn! Raging Nympho Bride Offers Up Her Anal Hole To Other Guys To Enjoy - Her Big Tits Filmed With A Fish Eye Lens Just To Get Them All In

  • censoredcreampiebig titsJYMAjukujo ha tsurai yobuddha dmanji groupJYMA-004JYMA004jyma00004
    • 2020-11-28
    45 min

    FC2PPV 1587094 ☆ ★ Limited time discount ★ ☆ Gonzo raw vaginal cum shot with Marisa Kirisame in the east + Cum without service blowjob! Ahegao exposed sex!

  • amateur uncensoredfc2
    • 2020-12-04
    480 min

    [DRC-021]Raw Footage Leaked Amateur Videos 6

  • censoredcreampiebig titsDRCprestigedocument recordDRC-021DRC021118drc00021
    • 2020-12-04
    56 min

    FC2PPV 1593535 Too cute nursery teacher Leak-Limited quantity-

  • amateur uncensoredfc2
    • 2020-12-07
    40 min

    [ore-726]スズ 3

  • amateur censoredcreampiebig titsoreore-726ore726ore-726
    • 2020-12-12
    68 min

    200GANA-2404 Seriously Nampa, first shot. 1567 I haven’t had an affair with my husband, and I have never had an affair! Picking up a married woman who has excess libido in Meguro! I knew it was a good idea, but I couldn’t resist my instinct

  • amateur censoredbig titsmarried womanganagana-2404gana2404200gana-2404
    • 2020-12-13
    147 min

    [DVAJ-490]"I Like You" A Confession From A Meek-Looking Factory Girl Turns Into A Wild Fuckathon - The Story Of How I Nailed Her Eight Times In A Row Ruka Inaba

  • inaba censoredcreampiebig titsDVAJalice japanbieber gonzoDVAJ-490DVAJ490dvaj00490
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-20
    480 min

    [EIH-057]Amateur Office Lady Private SEX: 8 Hours

  • censoredcreampieamateurEIHstar paradiseeight hEIH-057EIH057h-254eih00057
    • 2021-01-27
    50 min

    230OREC-677 Nene

  • amateur censoredcreampiebig titsorecorec-677orec677orec-677
    • 2021-02-01
    124 min

    [DROP-056]Amateur Girls With The Best Blowjob SK**ls!! 7

  • censoredamateurblowjobDROPoffice k sDROP-056DROP05636drop00056
    • 2021-02-08
    63 min

    328HMDN-335 J ★ Uniform refre super cute beautiful girl 19 years old ♪ “Nama is no good ~ ♪” Raw Saddle back op Refuse but secretly remove the rubber ♪ I am crazy about raw penis and covered with cloudy serious juice ♪ Oniden gun from the o

  • amateur censoredcreampieuniformhmdnhmdn-335hmdn335328hmdn-335
    • 2021-02-24
    128 min

    [BNST-026]Friends With Benefits Luna Holiday Fucking My Hot Fuck Buddy's Brains Out Runa Tsukino

  • tsukino luna censoredcreampiebeautiful girlBNSTteacher delusion groupkamagramBNST-026BNST026bnst00026
    • 2021-02-26
    118 min

    [GNAX-046]Nympho Wives Screaming In Pleasure In The Middle Of The Day - Filthy Fertility Massage They Can't Tell Their Husbands About - Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsGNAXnagiranagira kenzoGNAX-046GNAX046h-1345gnax00046
    • 2021-03-05
    67 min

    SIRO-4445 [First shot] [For your favorite band ..] [Slender x nice ass] Back part-time job started for your favorite band. Contrary to the appearance that seems to be pure, the sensitive girl who was hiding her sullen propensity .. Application amateu

  • amateur censoredamateursirosiro-4445siro4445siro-4445
    • 2021-03-07
    140 min

    [PKPD-136]POV Shots Of Black Pantyhose, Denim, And Cum Face Semen Splatter Ejaculations On A J* Natsuki & Airi

  • natsuki kisaragi airi takasaka censoredPKPDfuck group and fun friends daydreamersPKPD-136PKPD136pkpd00136
    • 2021-03-23
    129 min

    [SDAB-172]Adorable Art S*****t Takes Her 55-Year-Old Teacher's Creampie After School - Driving Footage - Sensitive, Slender Body Saya Kuriyama

  • saya kuriyama censoredcreampieschoolgirlSDABsod createrakudaone s youthSDAB-172SDAB1721sdab00172
    • 2021-03-24
    20 min

    10musume 032421_01 While She was giving a head, She Ｗet Herself Satomi Kinoshita

  • amateur uncensored10musume
    • 2021-04-10
    111 min

    [VENX-024]Step Family G*******g My Beautiful Step Aunt Akane Shiki

  • akane shiki censoredcreampiemature womanVENXvenussarufakecest winntersVENX-024VENX024venx00024
    • 2021-05-01
    63 min

    SIRO-4505 [First shot] [Innocent girl] [Natural H cup daughter] A shy and pure active college student participates in the war. While she was listening to the story, she was attracted to her charm and took off her cute clothes .. AV application on the

  • amateur censoredbig titsamateursirosiro-4505siro4505siro-4505
    • 2021-05-07
    130 min

    [GUN-853]If You Stretch Your Legs, You Can Be Synchronized Too! I Only Love Long, Thin Legs Now! Tsumugi Narita

  • narita tsumugi censoredsingle workGUNradixmg yukkyexceptionalGUN-853GUN853433gun00853
    • 2021-05-11
    129 min

    [KTRA-294]Giving My Smart Flat-Chested Step Sister A Creampie Hikari Nozomi

  • hope light censoredcreampieuniformKTRAk tribeKTRA-294KTRA294h-094ktra00294
    • 2021-05-18
    51 min

    396BIG-099 Ayumi

  • amateur censoredcreampieamateurbigbig-099big099396big-099
    • 2021-05-20
    120 min

    [SPZ-1104]Fucking On Tape For Money Cumming In Their Mouths After Blowjobs And Getting Jerked Off With Freshly Disrobed Panties 27 Girls

  • censoredamateurblowjobSPZstar paradisestar paradiesSPZ-1104SPZ1104h-254spz01104
    • 2021-05-21
    69 min

    491TKWA-173 SEX I-Cup Big Breasts Enko J ● I Just Learned Allows Creampie By Rolling Up Continuously!

  • amateur censoredcreampiebig titstkwatkwa-173tkwa173491tkwa-173
    • 2021-05-25
    65 min

    499NDH-019 An advancing addict who eats a man with his upper and lower mouths! This cowgirl won a great grand prize! !! Belochu LOVE carnivorous demon sexual desire is attacked and behaves in a big way! I thought that I was chin-pressed, but immediat

  • amateur censoredsquirtingamateurndhndh-019ndh019499ndh-019
    • 2021-05-28
    120 min

    [WAAA-066]Slow & Explosive Gear-Shifting P to P Action! She's Using Her Big Ass To Press Down On You With Cowgirl Sex And Then Using Her Colossal Tits To Give You An Overwhelming Titty Fuck An Infinite Orgasmic Loop Of Consecutive Cum Shots! J

  • julia censoredbig titssingle workWAAAwanz factorywanzWAAA-066WAAA066waaa00066
    • 2021-06-11
    145 min

    [IPX-678]Adultery Love - When I Creampied My Married Co-Worker - Nanami Misaki

  • nanami misaki censoredcreampiesingle workIPXidea pocketdishIPX-678IPX678ipx00678
    • 2021-06-11
    170 min

    [FFFS-028]Taking MILFs Home For A Fuck! Hidden Camera Footage Of Cougars Riding Strangers' Cocks 25 - Married Mature Sluts In Their Forties Crave Young Dick - Eiko, I-Cup, Age 40, Hot MILF Who Loves Younger Men - Shina, H-Cup, Age 41, Prim, Prett

  • censoredcreampiemature womanFFFSmature woman private videos emmanuellemanji groupFFFS-028FFFS028fffs00028
    • 2021-06-12
    61 min

    Caribbeancom 061221-001 In Front of Her Husband: Middle-aged husband who orders his subordinates to sex with a young wife Chisato Takayama

  • amateur uncensoredcreampiecaribbeancom
    • 2021-06-20
    240 min

    [NATR-660]She's Got Curves! Kyoko Kubo

  • kyoko kubo censoredmature womansingle workNATRnadeshikoNATR-660NATR660natr00660
    • 2021-06-25
    169 min

    [JUFE-299]Determined 20-Year-Old Fresh Face Rin Asahi G Cup Real Idol AV Debut Rin Asahi

  • rin asahi censoredbig titssingle workJUFEfitchJUFE-299JUFE299jufe00299
    • 2021-07-16
    55 min

    Caribbeancom 071621-001 The most important duty of nurse is helping patients ejaculate Yui Kisaragi

  • yui kisaragi uncensoredhandjobbukkakecaribbeancom
    • 2021-07-30
    124 min

    [NKKD-221]Her Daughter"s Boyfriend"s Cock Is Massive... The Housewife Who Was Fucked By The Boyfriend"s Massive Cock While Hiding From Her Husband And Stepdaughter.

  • ayaka muto censoredmature womanslutNKKDjet eizougroupNKKD-221NKKD221nkkd00221
    • 2021-07-30
    124 min

    [NKKD-220]夫婦念願の田舎暮らし…だがそこで農業従事者様のデカチンをめりめり挿れられてめろめろにされた妻 夕季ちとせ

  • chitose in the evening censoredsingle workNKKDjet eizougroupNKKD-220NKKD220nkkd00220
    • 2021-08-12
    224 min

    [SUN-023]First Exhibition And First Adultery After Marriage. Immoral Creampie Two Day Trip

  • aimi rui akikawa censoredbig titssingle workSUNsuntanaka baconSUN-023SUN02313sun00023
    • 2021-08-16
    81 min

    [MISG-001]Starting Today, No More Premature Ejaculation For Me!! - Make Japan Happy With The Power Of Daydream -

  • shinoda yu otsuki sound censoredcreampiebig titsMISGstimulation strongjohnny shibuyaMISG-001MISG001misg00001
    • 2021-09-04
    30 min

    FC2PPV 2149435 [Interview] A Serious F-Cup 19-Year-Old Active Jd Who Has Just Graduated. 2 Barrages Even Though It Is An Interview

  • amateur uncensoredfc2
    • 2021-09-10
    118 min

    [SSIS-167]She Went On A Business Trip With Her Boss, Whom She Absolutely Hated, And Found, To Her Surprise, That She Was Booked Into The Same Room With Him At The Inn ... This Beautiful Tits Office Lady Was Kept Cumming All Night With His Excessively

  • minami kojima censoredsingle workdramaSSISs1 no 1 stylemaeda bungouSSIS-167SSIS167ssis00167
    • 2021-09-24
    239 min

    [EKBE-004]I Want To Get Off On Her Today. BEST

  • nao wakana yuki god censoredblowjobslutEKBEwarp entertainmentk westcobra warpEKBE-004EKBE0042ekbe00004
    • 2021-09-24
    105 min

    [VEC-496]My Wife"s Close Friend Who Came To Lecture On About Scandalous Infidelity From A Playboy Husband. Reina Hirokawa

  • reina hirokawa censoredcreampiemature womanVECvenuskaniemegami venusVEC-496VEC496vec00496
    • 2021-10-01
    104 min

    [VENX-078]Wife"s Sister Suddenly Comes Onto Me And Milks Me For Two Whole Days, Akari Neo

  • akari neo censoredcreampiemature womanVENXvenuspe taincest vi nasuVENX-078VENX078venx00078
    • 2021-10-04
    51 min

    FC2PPV 2298473 Until 10/6 5800pt → 2900pt [First thing / outflow] * Forced 3P / 2 consecutive vaginal cum shot / cleaning W Blow * Sequel → Tragedy that attacks a couple on a date. A neat and clean body with a nice ass model, she begins to cry beyond

  • amateur uncensoredfc2
    • 2021-10-08
    155 min

    [BANK-056]Meet The S*****t Council Brats Who Group Fucked Their Hot Teacher And The Sexy PTA Chairwoman Honoka Kimura & Yuri Mizukawa

  • censoredcreampiebig titsBANKma ko ginkouyuuseiBANK-056BANK056h-1495bank00056
    • 2021-10-09
    58 min

    10musume 100921_01 Real Face Amateur: It’s Embarrassing To See My Face With Makeup Removed Because I’m A Childhood Friend Rena Hashimoto

  • amateur uncensored10musume
    • 2021-10-23
    37 min

    FC2PPV 2367020 [Personal Shooting] A Possible 18-Year-Old Vaginal Cum Shot To A Good-Looking Young Lady Ria Mitsuru [Mountain Shooting]

  • amateur uncensoredfc2
    • 2021-11-06
    141 min

    [APKH-190]A Beautiful Supplier With Colossal Tits Gets POV Fucked At A Love Hotel She"ll Happily Lick You And D***k Down Your Com ... This H-Cup Titty Horny Bitch Will Gladly Sleep Her Way To The Top In Order To Make A Sale Reona Tomiyasu 26 Year

  • takehiro tomiyasu censoredcreampiebig titsAPKHaurora project annexhAPKH-190APKH190apkh00190
    • 2021-11-08
    77 min

    345SIMM-675 [NTR] Husband Who Gets Excited When His Wife Flutters With Another Man … Planning Close-Up Nude Shooting With A Young Handsome Model. Even If My Wife Says No, She Ends Up Being Slimy ● I’m Attracted To This … Peep Into The

  • amateur censoredmarried womanamateursimmsimm-675simm675345simm-675
    • 2021-11-12
    150 min

    [BLK-533]First Anal for the Massive Ass! Hyper Anal Sex Hardcore, Maria Nagai

  • maria nagai censoredanalcreampieBLKkira kirakira hosi kira black galBLK-533BLK533blk00533
    • 2021-11-20
    170 min

    [DGCEMD-086]Available Exclusively! Bonus Footage Included. Losing Body And Mind To Get Submissive For Me - Rina Takase - See Her Get Lewd And Submissive As A Pet For Me.

  • rina takase censoredbig titsmature womanDGCEMDceleb no tomoDGCEMD-086DGCEMD086dgcemd00086
    • 2021-11-20
    89 min

    355OPCYN-201 Ichika 2 (Ichika Matsumoto)

  • amateur censoredcreampieamateuropcynopcyn-201opcyn201355opcyn-201



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored