3p 4p




FC2SSNIAVSAHODVIPXAUKGGVHSSISAUKGMEYDMIAAFSDSSVEMAHDKACHRVCAWDGMEMLULUVENXPPPDAUKS

2020-09-30
46 min

FC2PPV 1517997 [Uncensored / No Mo] Buyer review benefits available (high quality version) _ New limited sale until 10/31 [1980pt⇒1480pt] [It’s not bad to take it off] Yu & Misa (Rise, Meru) [Complete appearance] Clothes 3P Creampie SEX

  • amateur uncensoredfc2
    • 2020-09-30
    109 min

    [pow-025]マ○ュ@逆バニー

  • amateur censoredbig titsamateurpowpow-025pow025pow-025
    • 2020-10-01
    239 min

    [BUR-556]Innocent Country Beautiful Girl - The First Summer Vacation Experience 4 Hours

  • censoredcreampiebeautiful girlBURglay zburst graceBUR-556BUR55612bur00556
    • 2020-10-09
    151 min

    [SCPX-407]Wife, Is It Okay To Do It？ Your Breasts Touch Against Me So Defenselessly

  • censoredcreampiebig titsSCPXscoopmousouzokuSCPX-407SCPX407h-565scpx00407
    • 2020-10-23
    63 min

    417SRCN-040 Beautiful Cuckold F Breasts Best Friend Cuckold SEX Until Morning With Her! Even though my best friend is right next to me, I was addicted to my cock and cum shot many times to her and the semen is empty w

  • amateuramateur censoredcreampiebig titssrcnsrcn-040srcn040417srcn-040
    • 2020-10-29
    21 min

    HEYZO 2382 Erotic Massage for Mio – Mio Futaba

  • mio futaba uncensoredblowjobhandjobheyzo
    • 2020-10-31
    150 min

    [MIDE-841]Naughty Girlfriend Helps Her Boyfriend's Stepbrother With His Premature Ejaculation Problem While Her Man's Not Home. Minami Hatsukawa

  • hatsukawa minami censoredbeautiful girlslutMIDEmoodyzmamezawa mametaroumoodyz divaMIDE-841MIDE841mide00841
    • 2020-11-06
    48 min

    [gerk-320]カヨ

  • amateur censoredamateurslutgerkgerk-320gerk320gerk-320
    • 2020-11-14
    129 min

    [ARM-924]A Woman At My Office Discovered My Foot Fetish And Made Me Cum Over And Over With Her Sexy Feet vol. 2

  • star ameri aya mamiya censoredslutARMaroma planninghamu oujiaromaARM-924ARM924arm00924
    • 2020-11-18
    72 min

    SWEET-046 Ke ● ki saka

  • amateur censoredbig titsamateursweetsweet-046sweet046sweet-046
    • 2020-11-22
    119 min

    [CAWD-146]Cheating On Her Husband By Doing A Porn Video - Peerless Wife Unable To Stand Being Alone With Her Husband Gone On Business Becomes Porn Actress As Her Way Of Satiating Her Desires... Yua Yuzuki

  • yui yuki censoredsingle workdramaCAWDkawaiitiger kosakaiCAWD-146CAWD146cawd00146
    • 2020-11-27
    30 min

    359TYVM-108 G Cup Plump Big Areola Wife Motherhood Explosion Breastfeeding Play Creampie Sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-108tyvm108359tyvm-108
    • 2020-11-27
    57 min

    FC2PPV 1586131 Married woman 5P big orgy! ] Oil Puru Puru W Big Breasts I Cup Two Married Women Young Penis Chablis Crazy Bikini Wife ♥ Raw Saddle Creampie The Strongest Iki Rolled Personal Shoot [Big Breasts Bikini]

  • amateur uncensoredfc2
    • 2020-12-12
    149 min

    [DASD-776]Jealousy, Despair, Erections. She Found The "Adultery Brothel" Yuria Kanae

  • yulia kano censoredbig titsblowjobDASDdasrakudaDASD-776DASD776dasd00776
    • 2020-12-18
    68 min

    [ETQR-177](Daydream POV Fantasies) You Get To Look Into The Eyes Of A Tall And Beautiful Y********l In Uniform With Short Hair And Big Tits As You Fuck Her At A High-Class Hotel Miu Narumi

  • censoredcreampiebig titsETQRerotic timeETQR-177ETQR177h-1186etqr00177
    • 2020-12-20
    240 min

    [REXD-348]A Targeted Woman A Plain Jane Girl Who Works Part-Time At A Factory "You've Got A Nice Body There... And Your Ass Looks Nice And Tight!"

  • censoredcreampieREXDredgroupREXD-348REXD348rexd00348
    • 2020-12-29
    55 min

    C0930 ki210105 Chiemi Itaya 43years old

  • amateur uncensoredc0930
    • 2021-01-15
    47 min

    FC2PPV 1645865 [Personal shooting] Ginza club mom raises funds to protect the store Enko! Raw insertion cum shot in glamorous big ass

  • amateur uncensoredfc2
    • 2021-01-15
    45 min

    FC2PPV 1644887 Operator

  • amateur uncensoredfc2
    • 2021-01-22
    88 min

    [SS-013]Natural Beauty - Kana Mizuto

  • kobayakawa reiko aiba reika censoredcreampiebig titsSSplumSS-013SS01313ss00013
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    124 min

    [RCTD-382]Naked Oil Kat Lesbian Fight 4

  • arimura nozomi aya mitsuki censoredlesbianRCTDrocketscarecrowRCTD-382RCTD3821rctd00382
    • 2021-02-12
    49 min

    FC2PPV 1683388 [Personal shooting] The beauty receptionist of a department store has drastically reduced her work, and she is desperate to earn living expenses! [Creampie]

  • amateur uncensoredfc2
    • 2021-02-16
    111 min

    [MXGS-1170]I Met My Female Friend For The First Time In A Long While, And Her Tits Have Gotten So Big I Can't Help But Get Excited... Sachiko

  • sachiko censoredbig titsbeautiful girlMXGSmaxingMXGS-1170MXGS1170h-068mxgs01170
    • 2021-03-01
    60 min

    492MERC-239 Innocent erotic curiosity 2

  • amateur censoredamateurmercmerc-239merc239492merc-239
    • 2021-03-09
    54 min

    FC2PPV 1719080 First shot ❤️ Petite and slender, but being mischievous by a de S twinte girl [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-12
    136 min

    [GNAB-048]This Is So Risky But It Feels So Good... "If You Don't Go All The Way Your Husband Might Find Out" I Caught The Boss's Wife A Hostess Club For Mature Hotties, And Told Her I'd Post It Online If She Didn't Put Out...

  • censoredslutGNABprestigebang prestigeGNAB-048GNAB048118gnab00048
    • 2021-03-16
    137 min

    [SDMM-087]Orgasm Bicycle + Mirror For Delivery Girls WIth Nice Asses Only! New Model Of Orgasm Bike Is Designed So The More The Rider Pedals The Faster The Huge Dildo Attached To The Seat Fucks Her! She Cums And Sprays As She Has Her Ass Fucked In Fr

  • censoredsquirtingamateurSDMMsod createdainanamagic mirrorSDMM-087SDMM0871sdmm00087
    • 2021-03-18
    120 min

    [C-2622]Day Trip Spa Mature Woman Lust Trip #018

  • aikawa kyouko censoredmarried womanmature womanCgogoskoichi takahashicore gogo sC-2622C2622
    • 2021-03-27
    53 min

    292MY-422 Hikari Shimodaira 2

  • amateur censoredcreampiebig titsmymy-422my422292my-422
    • 2021-03-30
    108 min

    [RD-1048]A Filthy Showa Sensual Drama A Poor Mother With 3 K*ds Needed To Make More Money, So She Offered Up Her Body ... When The Landlord Paid Her A Night Visit, This Innocent Wife Wept And Thrashed Her Body With Dedicated Passion

  • yoko ikeda yu miyajima censoredmarried womanblowjobRDathena videomurayamaathenaRD-1048RD1048149rd01048
    • 2021-04-05
    85 min

    469G-629 #Saddle Girl Yuri

  • amateur censoredcreampiebig titsgg-629g629469g-629
    • 2021-04-14
    51 min

    515BTGL-001 Yui (27)

  • amateur censoredcreampiebig titsbtglbtgl-001btgl001515btgl-001
    • 2021-04-23
    59 min

    FC2PPV 1783989 [Actual record] G-cup 18-year-old house I met in Kabukicho, Shinjuku ● I quarreled with my daughter and parents and stayed at a manga cafe

  • amateur uncensoredfc2
    • 2021-05-07
    152 min

    [DASD-858]I'm A Lowly S*****t, But I Succumbed To The Sweet Temptation Offered By Two Female Teacher Babes, And Now, After School, We're At The Love Hotel, Having Creampie Sex, Over And Over And Over Again. Waka Misono Yuria Yoshine

  • misono waka yoshine yuria censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-858DASD858dasd00858
    • 2021-05-21
    159 min

    [AKID-084]@I Started My Sex Life!! #Takehome vol. 3

  • censoredcreampieAKIDtake outmanji groupAKID-084AKID084akid00084
    • 2021-05-28
    120 min

    [MIAA-440]~ Super Beautiful Woman Gets Ravished By Her Husband's Boss HH]Z]^H

  • hikari hime censoredcreampiebig titsMIAAmoodyzsuisei akaieveryone s porn starMIAA-440MIAA440miaa00440
    • 2021-06-20
    240 min

    [NASH-528]Elegy For A Showa Wife - She Repays Her Husband's Loans With Her Body - Ravished By His Boss, His Lender, And Even A TV Reporter

  • censoredbig titsdramaNASHnadeshikocharlie miyazakiNASH-528NASH528nash00528
    • 2021-07-02
    241 min

    [DVDMS-684]Ordinary Guys And Girls Caught On Camera - We Thoroughly Investigate The Lust Level of College S*****t Amateur: If They Manage Not To Fuck, They Win 10 Grand! Male/Female Friends Who've Missed The Last Train Home Are Offered The Chance

  • censoredcreampieamateurDVDMSdeep ssuttorune iwanagaDVDMS-684DVDMS684dvdms00684
    • 2021-07-03
    97 min

    [VENX-053]She Can't Live Without Her Stepson Anymore... 50 Orgasms Push This Horny Stepmom To Her Upper Limit With Creampie Sex Yuna Kitano

  • yuna kitano censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-053VENX053venx00053
    • 2021-07-06
    121 min

    [KUSE-017]If You're In The Mood For Fucking, Get Some Instant Pussy! Bust: 100cm x Hips: 100cm This Currently Active Office Lady Is A Big Hole Natural Airhead With A Voluptuous Body And She's Making Her Adult Video Debut!! A Natural Born Bitc

  • jun asami censoredbig titssingle workKUSEsod createsandmanthis actress style is amazingKUSE-017KUSE0171kuse00017
    • 2021-07-07
    106 min

    YRM-006 Hijiri

  • amateur censoredamateurmature womanyrmyrm-006yrm006yrm-006
    • 2021-08-05
    113 min

    1Pondo 080521_001 Shino Aoi Megu Memesawa : Sexy Actress Special Edition Shino Aoi Megu Memezawa

  • amateur uncensored1pondo
    • 2021-08-16
    152 min

    FC2PPV 2035326 Free Announcer Outflow * Limited Quantity *

  • amateur uncensoredfc2
    • 2021-08-21
    72 min

    10musume 082121_01 With My Friend: Had A Sexual Orgy Party With Friends Akari Yuki Hina Mizushiro

  • amateur uncensored10musume
    • 2021-09-02
    75 min

    FC2PPV 2089132 [Leaked] Girls Band Vocal K (20) Boyish Big Breasts Diva’S Private Girl’s Face Creampie Gonzo Leaked [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-09-04
    126 min

    [AVSA-179]Master"s Dirty Obedient Pet Bukkaked And Sweaty Miho Tono

  • miho tsuno censoredsingle workbukkakeAVSAavsjinguuji hikariavscollectorsAVSA-179AVSA179avsa00179
    • 2021-09-10
    152 min

    [JUL-699]Respectable Teacher For The Youth. 30-Year-Old H-Cup Married Woman That Teaches Youth For A Living Makes Her AV Debut!!

  • riame nagata censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-699JUL699jul00699
    • 2021-09-16
    115 min

    [336DTT-088]超ハイスペック美脚妻 現役国際線CA 福永ねお 32歳 AVデビュー

  • amateur censoredmarried womanamateurdttdtt-088dtt088336dtt-088
    • 2021-09-25
    239 min

    [NASH-579]The Adulterous Sex Of 30 Mature Women From The Showa Era - 50 And 60-something Wives Who Want To Be Fucked

  • censoredmature womanNASHnadeshikoitou hajimeNASH-579NASH579nash00579
    • 2021-10-05
    71 min

    476MLA-051 Picking Up Girls In A Half-Beautiful Girl! The Second Round Of Facial Cumshots! !! Gonzo Record With A Boyfriend’s Maiden Who Can Not Stop Cheating (Rina Takase)

  • amateur censoredcreampiebig titsmlamla-051mla051476mla-051
    • 2021-10-15
    99 min

    277DCV-192 Is It Okay To Send It Home？ Case.186 [* Be Careful Of Eardrum Explosion! Gasping Voice Max! It’s Too Masochistic And Full Of Highlights Sp] ⇒ Strangling Iki, Nipple Iki, Iramaiki, Just Sweaty And Crazy Iki! Gakuburudo M Makai! ⇒ Perfe

  • amateur censoredsquirtingamateurdcvdcv-192dcv192277dcv-192
    • 2021-11-20
    132 min

    [SCPX-436]My Step Father-in-law Suddenly Kissed Me So Well That I Lost My Back And Felt My Body Warp, And My Earnest Wife Instantly Turned Into A Female In Heat!

  • censoredcreampieSCPXscoophasshimousouzokuSCPX-436SCPX436scpx00436
    • 2021-12-03
    33 min

    520SSK-038 Mao-Chan’s Virgin Brush Wholesale (Mao Hamasaki)

  • amateur censoredcreampiebig titssskssk-038ssk038520ssk-038
    • 2021-12-08
    45 min

    508HYK-018 Ikeike Sister ＃ 18 Tsubaki The Body Of A Mature Woman Who Enjoys Her Hard Orgy

  • amateur censoredcreampieamateurhykhyk-018hyk018508hyk-018
    • 2021-12-17
    123 min

    [FOCS-039]All I Wanted Was To Become An Idol ... I Deceived This Boyish Beautiful Girl And Pounded Her Pussy To Pieces!! A Squirting Sexual Experience Of Despair After Being Cornered Into An Unscrupulous Contract Nana Hayami

  • don t be quick censoredcreampiesquirtingFOCSabc mousouzokufocusFOCS-039FOCS039focs00039



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored