back girl




FC2SPRDSSISSQTEDTTHMNATIDDASDCAWDSHKDLULUAMBIIPXADNAUKGMIDEWANZMARANACRHODVMEYD

2020-12-11
239 min

[SOUD-019]Pure, Innocent Beautiful Girl With A Shaved Pussy Takes Massive Creampie Loads!

  • censoredcreampieamateurSOUDprestigebest fuckingSOUD-019SOUD019118soud00019
    • 2020-12-22
    107 min

    [MSC-001][Private Footage] Threesome Repeated Creampies! 19-Year-Old Baby-Faced Local Idol "I Don't Wanna Get Pregnant" Taking Off The Condom Partway Through And Giving Her The Dick Raw! It Feels Too Good So I Came Inside Her!!

  • amateur censoredcreampieamateurMSCfutureMSC-001MSC001
    • 2020-12-25
    83 min

    [DHT-234]Lewd Propensities That I Cannot Tell Anyone From My Former RQ! Mayumi Ono, 30 Years Old

  • censoredamateurslutDHThot entertainmentshungoDHT-234DHT23459dht00234
    • 2020-12-27
    115 min

    [JJBB-0002]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 02

  • censoredcreampiemarried womanJJBBmature japanJJBB-0002JJBB0002jjbb000002
    • 2020-12-29
    56 min

    FC2PPV 1624824 [If you get caught, it ’s dangerous → Appear on your own! ] Daddy activity before studying in Australia ❤ Experienced as a campaign girl at a famous car show overseas JD! All-you-can-eat raw cock in a super rare tight pussy in a slaugh

  • amateur uncensoredfc2
    • 2021-01-24
    100 min

    [NSPS-962]Posted True Stories: My Wife Got G*******ged 13 - Tragedy At A Campsite - Hijiri Maihara

  • kiyoshi maihara censoredmature womansingle workNSPSnagae stylenagaeNSPS-962NSPS962nsps00962
    • 2021-01-29
    49 min

    FC2PPV 1663333 [No] 1/31 Deleted Video scale 90 minutes Limited 50 pieces Please understand the reason why many can not be distributed [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-05
    73 min

    HEYZO 2485 Requesting The POV Fuck Option -Shinagawa- – Kira

  • kira uncensoredheyzo
    • 2021-02-05
    93 min

    380SQB-087 Ena

  • amateur censoredbig titsamateursqbsqb-087sqb087sqb-087
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-19
    130 min

    [SKEJ-006]A Pure Beautiful Girl With Black Hair!! Employee At A Family Restaurant Natsuki-chan

  • censoredcreampiebeautiful girlSKEJamateur time delusion groupSKEJ-006SKEJ006skej00006
    • 2021-02-27
    76 min

    300MAAN-629 [Ultimate Saseko Advent] An ideal extreme erotic BODY that you can’t think of as neat (self-proclaimed)! Bubble ass job play to play with each other in the bath! Unique to soft girls! Adhesion etch in an impossible position! !! Super

  • amateur censoredcreampieamateurmaanmaan-629maan629300maan-629
    • 2021-02-28
    56 min

    230OREX-213 Ruka san

  • amateur censoredcreampiebig titsorexorex-213orex213230orex-213
    • 2021-03-04

    FC2PPV 1710558 Limited number [Uncensored] Night aquarium date with nursery teacher and continuous vaginal cum shot (88 minutes)

  • amateur uncensoredfc2
    • 2021-03-05
    122 min

    [UMD-771]Partied Out Married Women 3: When Her Husband Is Out... You Get Horny When You Party, Don't You, Mrs.？

  • nene tanaka kanon kanon censoredbig titsUMDleodragon nishikawaUMD-771UMD771125umd00771
    • 2021-03-11
    480 min

    [DANDY-753]There's Always A Reason For Sex! 10 Kind Nurses Who Help Out Their Horny Patients

  • censoredcreampiebig titsDANDYdandykikujiro otsuDANDY-753DANDY7531dandy00753
    • 2021-03-13
    139 min

    [BADA-013]Married Woman Looking For Lovers Michiru Manaka

  • aichi michiru censoredcreampiesingle workBADAbaltanusubashisuidiamondBADA-013BADA013bada00013
    • 2021-03-13
    111 min

    FC2PPV 1724301 [Caution for viewing mental collapse] [* Limited quantity *] 6P orgy training, declaring slaves, anal service, deep throating, Dirty language training, demon Ikase, anal development, spanking, swallowing, vaginal cum shot, dignity dest

  • amateur uncensoredfc2
    • 2021-03-19
    87 min

    300NTK-537 [Beautiful ass slender moody beautiful girl! !! ] Libido that can not be hidden! !! Muramura date with a beautiful girl flower shop over idols! !! Suspicion of being embraced! ？？ What is her determination to challenge with a apt T-back 

  • amateur censoredcreampieamateurntkntk-537ntk537300ntk-537
    • 2021-03-21
    78 min

    345SIMM-623 A cheerful little J ○ and a nasty day! Hotein from noon → Sperm drinking blowjob & mass cum shot SEX! I thought I was going to bed on that day, but I crawled my uncle at night with the erotic shrine maiden costume that I brought with m

  • amateur censoredcreampieuniformsimmsimm-623simm623345simm-623
    • 2021-03-23
    43 min

    H4610 ki210323 Yukari Kitagawa 20years old

  • amateur uncensoredh4610
    • 2021-03-24
    82 min

    FC2PPV 1739436 980 yen! Big breasts J cup ♪ First shot suddenly vaginal cum shot! The tight boobs are sloppy ♪ Although I am puzzled by the body that is too sensitive, I forget to shoot and drown in pleasure and die! 21-year-old JD3 May-chan Chapter

  • amateur uncensoredfc2
    • 2021-04-14
    121 min

    [SSIS-045]His Daughter's Friend Loves Him - And Their Grandad, And Brothers - A Family Of Four Men All With Excellent Sex Genetics Ready To Breed Her Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsingle workSSISs1 no 1 styleamazing meatSSIS-045SSIS045ssis00045
    • 2021-04-15
    149 min

    [KTKC-113]"You Deserve To Nail A Girl With Big Tits" Exciting Discovery: Adorable Submissive Cutie With Short Hair Takes Off Her Clothes To Reveal Massive G-Cup Marshmallow Tits Ayaka

  • censoredbig titsamateurKTKCkitixx mousouzokujizo pokochinbig titsKTKC-113KTKC113ktkc00113
    • 2021-04-20
    120 min

    [SPZ-1101]Money Shots: Blowjob Loads Blown In Mouths And Handjobs With Freshly Stripped Pantyhose 8 Girls

  • censoredblowjobhandjobSPZstar paradisestar paradiesSPZ-1101SPZ1101h-254spz01101
    • 2021-04-27
    139 min

    [KIRE-030]"If I Keep On Cumming Like This, I'm Going To Lose My Mind ..." When This Married Woman Received A Dose Of Aphrodisiacs, Her Pussy Transformed Into An Excessively Amazing Tight Little Cunt ... May I Have Sex With You!？ His Huge

  • soma censoredsquirtingsingle workKIREsod createdainanabeauty kirei sodKIRE-030KIRE0301kire00030
    • 2021-05-07
    117 min

    [NEO-759]Long Hair Cum Shot Hana Himesaki

  • himesaki hana censoredbig titssingle workNEOradixshio sakurabaneo radixNEO-759NEO759433neo00759
    • 2021-05-28
    170 min

    [MIDE-931]My Ex Was About To Get Married, So She Got In Touch And We Had Incredible Creampie Sex ... Minami Hatsukawa

  • hatsukawa minami censoredcreampiesingle workMIDEmoodyzbacon tanakamoodyz divaMIDE-931MIDE931mide00931
    • 2021-06-02
    134 min

    [GVH-243]The Lewd Metamorphosis Of A Sober Busy Woman With Glasses - Sachiko

  • sachiko censoredcreampiebig titsGVHglory questaida yumenoGVH-243GVH24313gvh00243
    • 2021-06-17
    14 min

    FC2PPV 1873287 For a limited time [Individual shooting] Prefectural General Course ③ A girl who is sexually perverted by inserting raw into a burning body after a massage at a cheer club / hot spring hotel.

  • amateur uncensoredfc2
    • 2021-07-08
    122 min

    [HBAD-588]The Lewd Body Of A Female Employee Who Cannot Refuse To Have An Affair With Her Boss - Koharu Asai

  • asai censoredsingle workdramaHBADhibinoumanami jirobabeHBAD-588HBAD5881hbad00588
    • 2021-07-16
    107 min

    420HOI-192 Kano

  • amateur censoredbig titsamateurhoihoi-192hoi192hoi-192
    • 2021-07-24
    151 min

    [MCSR-443]A Slutty Apartment Wives With Colossal Tits: Beautiful, Mature Women In The Neighborhood Who Are Frustrated: Two Women Who Sleep Around

  • oda mako kiriko imato censoredbig titsmature womanMCSRbig morkalmascottMCSR-443MCSR44357mcsr00443
    • 2021-08-06
    54 min

    328HMDN-389 [Individual / Abs] An Elite Female Doctor, 45 Years Old, Is Completely Obedient To A Low-Educated Cock. Outflow Video That Is Blamed As Much As You Like For The Body Trained By Young People And Convulsions

  • amateur censoredcreampiemarried womanhmdnhmdn-389hmdn389328hmdn-389
    • 2021-08-13
    121 min

    [PPPD-955]Spence Breast Development Clinic Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsPPPDoppaiPPPD-955PPPD955pppd00955
    • 2021-08-21
    149 min

    [CEMD-048]First Anal! Aisha Yuzuki - Her Whole Thick And Curvy Body Gets Penetrated In Every Hole By Thick Objects Thrusting Away! Her Expanding Asshole Starts Making Lewd Noises!

  • yuzuki aisha censoredbig titsmature womanCEMDserebu no tomoCEMD-048CEMD048cemd00048
    • 2021-08-24
    152 min

    [SDNM-297]New Mom Dreams Of Shopping With Her Step-daughter In The Future. 23-Year-Old Ayano Kinoshita. Chapter 2. Husband And Wife Spend Time At Home While Breast Milk Just Doesn"t Stop Spraying Everywhere.

  • kinoshita ayame censoredsingle workSDNMsod createdainanahonmono hitodzuma dannani naisho de av taikenSDNM-297SDNM2971sdnm00297
    • 2021-09-09
    239 min

    [SVDVD-875]The Magic Mirror Number Bus Hard Boiled You Wanted To Go Picking Up Girls, So This Is What You Said To This Real-Life Nurse, "I"m An Intern At Your Hospital, And I Would Like For You To Be A Test Subject For This Cutting-Edge Medic

  • censoredanalcreampieSVDVDsadistic villagekindaichishougo roumagic mirror sadistic villageSVDVD-875SVDVD8751svdvd00875
    • 2021-09-12
    80 min

    413INST-159 [4th Idol] Negotiations Immediately After The Announcement Sex [Skits] Out Raw Squirrel At An Individual Handshake Event With The Idol

  • amateur censoredcreampieuniforminstinst-159inst159413inst-159
    • 2021-09-24
    111 min

    [WZEN-049]Banned 02: Life Insurance Salesperson Keiko (26)

  • censoredcreampiesquirtingWZENwaap entertainmentnaomiWZEN-049WZEN0492wzen00049
    • 2021-10-07
    222 min

    [NHDTB-587]A Big Tits S********l In Uniform Gets Groped And Grabbed From Behind And Wiggles Her Ass On A Crowded Bus By A Titty Grabbing M****ter 14

  • censoredbig titsschoolgirlNHDTBnatural highjaken kodamaNHDTB-587NHDTB5871nhdtb00587
    • 2021-10-08
    60 min

    FC2PPV 2314672 * Until 10/10 3980⇒2980 ★ First Shot ☆ 147cm Mini Small Breasts Loli Body ♥ Cute Bishoujo Harupyon 18 Years Old ☆ Excellent Sensitivity! Geki Iki Squirting Pussy ♥ Big Cock Is Thrust Into A Small Body And Faint In Agony Iki Rolled Vagi

  • amateur uncensoredfc2
    • 2021-10-15
    123 min

    [BOBB-324]J-cup Ultra Colossal Tits. Boin "Misono Mizuhara" Box. The Busty "Boin" Master Returns! These Big Tits Are Perfect To Lick, Rub, And Titty Fuck. They"ll Make Any Big Tit Lover Go Crazy For Them!

  • suwon miso censoredbig titsbeautiful girlBOBBabc mousou zokuboinbb abc mousou zokuBOBB-324BOBB324bobb00324
    • 2021-10-16
    61 min

    Pacopacomama 101621_546 Punishing A Mature Woman Who Feels Excessive Misato Wakaba

  • amateur uncensoredpacopacomama
    • 2021-10-22
    119 min

    [JYMA-015]Tall Wife With Big Tits And A Big Ass To Lure Men In Temptation. Super Horny Slutty And Masochistic Wife. Lewd Wife Teases With K-cup Tits For Horny Fun. Eri Takigawa

  • eri takikawa misato arisawa censoredcreampiebig titsJYMAtsukuzuku onna wa tsurai yobuddha dgroupJYMA-015JYMA015jyma00015
    • 2021-10-22
    154 min

    [DASD-926]My Cute Girlfriend That Loves Me Was Being Mating Pressed By My Stepfather. Ranka

  • ranka censoredcreampiesingle workDASDdasmishima rokusaburoDASD-926DASD926dasd00926
    • 2021-11-04
    244 min

    [CVDX-469]The Old Lady Has Huge Panties With a Deep Crotch - 30 People 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-469CVDX469h-086cvdx00469
    • 2021-11-20
    67 min

    300NTK-662 [Youth Hatsuratsu P Activity] [Hidden Beauty Big Tits] [Orthodox Beautiful Girl Namachin Success Or Failure Ww] The Secret Of The Orthodox Beautiful Girl Was Beautiful Big Tits! !! Just A Treasure! !! Sensitivity Bottle The Best Surprise!

  • amateur censoredcreampieamateurntkntk-662ntk662300ntk-662
    • 2021-11-29
    52 min

    FC2PPV 2471454 Limited Number! !! [Uncensored] Twilight Date On The Beach At Sunset With The Receptionist Of The Beauty Clinic … Obscene In A Closed Room With A Viewer And The Last Vaginal Cum Shot On An Elegant Body! !! This Is Her Last Work &#

  • amateur uncensoredfc2
    • 2021-12-03
    139 min

    [ATID-487]Her First Anal Fuck The Documentary There Are No Words To Describe This Brave Anal Virgin Deflowering! Ren Usui

  • usui ren censoredsingle workATIDattackershaga eitarouin madATID-487ATID487atid00487
    • 2021-12-15
    28 min

    FC2PPV 2518531 A Slender Gal Of A Tekiya. "Put In" And Begging For "Ikuiku" Barrage And Vaginal Cum Shot * Limited To 100 Year-End Specials

  • amateur uncensoredfc2
    • 2021-12-18
    119 min

    [DDOB-100]Tongue Scream Anaconda Deep Throat Nanase Iori

  • iori nanase censoredmature womandeepthroatDDOBdogmatenunmy auntDDOB-100DDOB100ddob00100
    • 2021-12-24
    160 min

    [JUL-801]Madonna"s Exclusive Rio Kuriyama"s Three Passionate Kisses With Saliva Overflowing With Adult Sex Appeal

  • rio kuriyama censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-801JUL801jul00801
    • 2022-01-27
    108 min

    [CHERD-079]Losing My Virginity To A Hot Family Friend, Intense Sex With A Cream Pie Starring Yuna Kitano

  • yuna kitano censoredcreampiemature womanCHERDcenter villagejiro fukagawahanazono center villageCHERD-079CHERD079h-086cherd00079
    • 2022-01-30
    94 min

    FC2PPV 2634136 Deviation Value 68, Super Prestigious University Active Female College Student Appeared! !! A Pure White Pure Girl With No Experience Of Cabaret Or Customs! !! The Deputy Director Of The Dance Club Who Participated In The National Comp

  • amateur uncensoredfc2
    • 2022-02-05
    235 min

    [MMMB-065]Sharing A Room On A Business Trip With A Boss That Engages In Sexual Harassment! Exhausted Employee Ends Up Having to Take 4 Hours Of Creampies.

  • censoredcreampiebig titsMMMBmellow moonMMMB-065MMMB065mmmb00065



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored