bubble




FC2ABWNGODVENXSANMIDVHDKAFSDSSMIDESQTEDASDAPODNNPJHMNJUFEMILKMARAJULKBIAUKGWAAA

2020-09-10
102 min

[RCTD-350]The New Employee Is A Basilisk Man 2, Company Edition, Akari Niimura

  • akari shinmura censoredsingle workRCTDrocketcentral yamamotoRCTD-350RCTD3501rctd00350
    • 2020-09-13
    66 min

    SIRO-4267 [First Shot] [Sweaty Sex With Desperate Cum] [Sensitive Body] An Innocent 20-Year-Old Female College Student. She Was Shy Because She Fluttered Her Legs With A Naughty Question .. AV Application On The Net → AV Experience Shooting 1340

  • amateur censoredsquirtingamateursirosiro-4267siro4267siro-4267
    • 2020-09-27
    95 min

    [VAGU-232]For My Beloved Husband... I Decided To Become A Sexual Mannequin - The Legend Of The Beautiful Mannequin Wife - Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsVAGUvenuspeterultimaVAGU-232VAGU232vagu00232
    • 2020-10-14
    34 min

    FC2PPV 1533894 [Individual shooting, nothing, appearance, NTR, fucking, fucking, fetish] Blow & fucking to another married woman with Gcup beauty big tits who has transformed into lewd! It will serve a lot of dicks other than her husband with an

  • amateur uncensoredfc2
    • 2020-10-16
    69 min

    FC2PPV 1536234 Beautiful slender beauty big tits and love love rich SEX 2 barrage ♥ ️ ♥ ️ [Personal shooting]

  • amateur uncensoredfc2
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-24
    136 min

    [CAWD-134]Rare Discovery! Adorable Former Newscaster With A Voice That'll Make You Rock Hard - Female Announcer Tsumugi Narita Makes Her Hard-Grinding Cowgirl Porn Debut

  • narita tsumugi censoredhandjobsingle workCAWDkawaiimametaro mamezawaCAWD-134CAWD134cawd00134
    • 2020-11-01
    87 min

    [SS-006]LOVE MOMENT - Touka Rinne

  • yuki misa kana ohori censoredbig titsSSglory questSS-006SS00613ss00006
    • 2020-11-13
    94 min

    SMUK-030 Kurumi 2

  • amateur censoredschoolgirlamateursmuksmuk-030smuk030smuk-030
    • 2020-11-24
    130 min

    [MSFH-038]S&M Inn - Traditional Inn Owner In Debt Offers Sensual Services To Support Her Business Madoka Shizuki

  • madoka shizuki censoredbdsmsingle workMSFHsod createryo inugamims sodMSFH-038MSFH0381msfh00038
    • 2020-11-28
    240 min

    [BDSR-432]Married Woman Real Adultry Leaked Love Hotel Voyeur Special A Furious And Erotic Scream-Filled Consecutive Cum Shot Orgasmic Fuck Fest 20 Ladies 4 Hours 2

  • censoredBDSRbig morkalBDSR-432BDSR43257bdsr00432
    • 2020-12-11
    32 min

    HEYZO 2437 Rei Now Experiences Double Barrel And Multiple Creampies To Be A Pro Prostitute – Rei

  • rei uncensoredheyzo
    • 2020-12-11
    47 min

    359TYVM-111 Sexy dripping beautiful breasts wife love juice leaking cum cum shot sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-111tyvm111359tyvm-111
    • 2020-12-11
    94 min

    483SGK-006 [Glamorous Emperor] [Latin Big Breasts] [Open all year round horny beast] [Paipan] The 3 best Hs I’ve ever felt good about are … Rolls Royce, in the mountains, karaoke shops are abnormal, aren’t they？ Latin glamorous huge br

  • amateur censoredcreampiebig titssgksgk-006sgk006483sgk-006
    • 2020-12-11
    120 min

    [XRW-951]The Ultra Widow What Happened Next... Kanna Misaki

  • kanna misaki censoredsingle workXRWreal workshide kingdokuji picturesXRW-951XRW951172xrw00951
    • 2020-12-17
    240 min

    [HUNTA-910]"What？ You're Going To Do That For Me Too？？ But I'm Going To Cum!!" An Angel In White Has Cum Down To Earth! She'll Suck And Slurp Up Every Last Drop Of My Semen With Her Tight Pussy Vacuum-Powered Cowgirl...

  • censoredcreampieuniformHUNTAhuntervolvo nakanohhh groupHUNTA-910HUNTA910hunta00910
    • 2020-12-27
    58 min

    H0930 ki210101 Kazue Aoi 52years old

  • amateur uncensoredh0930
    • 2021-01-09
    62 min

    Caribbeancom 010921-001 The Story Of Luxury Spa Lady, Vol.87 Chika Yoda

  • chika yoda uncensoredcreampiehandjobcaribbeancom
    • 2021-01-25
    58 min

    FC2PPV 1658362 January only [Uncensored] Supporting local hard-working students. Coming-of-age photography in the city. Continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-31
    43 min

    493PKPD-086 [Odorless] Complete training of intense M JD with a big cock and strangling

  • amateur censoredcreampieamateurpkpdpkpd-086pkpd086493pkpd-086
    • 2021-02-01
    120 min

    [NACR-392]Seduced By My Son's Horny Bride Yu Kawakami

  • yu kawakami morino morino censoredcreampiemature womanNACRplanet plusbito sakurananakuruNACR-392NACR392h-237nacr00392
    • 2021-02-01
    176 min

    [YMDD-213]Woofer Bitch: Pick Your Woman, Pick Your Time, Pick Your Place!

  • nene tanaka ayuka kuroda censoredblowjobbeautiful girlYMDDmomotaro eizodukewakamomoYMDD-213YMDD213ymdd00213
    • 2021-02-03
    20 min

    10musume 020321_01 Wanna Cum Blowjob Between Tits Mai Maruyama

  • amateur uncensored10musume
    • 2021-02-05
    75 min

    259LUXU-1377 Luxury TV 1362 A fascinating beauty busty bank clerk who says it was developed in the previous shoot and is easier to feel is back! Keep an eye on her too dense instinct full-blown sex that became a hedonist, exposing her glamorous body

  • amateur censoredbig titsamateurluxuluxu-1377luxu1377259luxu-1377
    • 2021-02-13
    115 min

    [VENX-007]Whispered Temptation So Daddy Doesn't Hear - MILF Seduces Her Stepson Nao Nakano

  • nanao nakano censoredcreampiebig titsVENXvenuskanyeincestVENX-007VENX007venx00007
    • 2021-03-01

    FC2PPV 1707259 Amateur Gonzo 40

  • amateur uncensoredfc2
    • 2021-03-03
    44 min

    362SCOH-039 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Ai]

  • amateur censoredcreampiebig titsscohscoh-039scoh039362scoh-039
    • 2021-03-05
    87 min

    [ZOZO-056]The New Female Teacher: Saya Sakura Tsukishima's Shame! Sexual Education At An All-boys' School

  • censoredcreampiebig titsZOZOsadie willenauZOZO-056ZOZO0561zozo00056
    • 2021-03-06
    122 min

    [NKKD-197]Housewife Sweetly Wrapping A Younger Horny Guy Up In Her Freshly Worn Underwear And Milking Him Dry - Ka Ayano Fuji

  • ayano kato censoredbig titsmature womanNKKDjet eizomanji groupNKKD-197NKKD197nkkd00197
    • 2021-03-11
    56 min

    FC2PPV 1721367 [No appearance] Extremely superficial beauty with beautiful legs and raw squirrel SEX Awakening of metamorphosis propensity with a too naive pussy demon piss with almost no experience number "Poke more deeply" Ahegao exposed wi

  • amateur uncensoredfc2
    • 2021-03-26
    125 min

    [WZEN-044]Video Seduction - Bored College Girl Rents Cock For SEX In Her Spare Time

  • censoreduniformblowjobWZENwaap entertainmentWZEN-044WZEN0442wzen00044
    • 2021-03-30
    61 min

    Caribbeancom 033021-001 Because She Wanted To Have SEX, Got A Job At The Massage Shop Yurie Minamisawa

  • amateur uncensoredcreampiehandjobcaribbeancom
    • 2021-04-17
    229 min

    [REXD-361]While You Were Away At The Office... Your Father Came Inside Me "My Son Isn't Enough To Satisfy You, Is He？ How About Me？"

  • censoredcreampieREXDredmanji groupREXD-361REXD361rexd00361
    • 2021-04-18
    59 min

    [BAB-027]This Beautiful Girl Came All The Way To Tokyo To Audition, And She's Working Hard To Pay Her Travel Expenses. She'll Never Know I Sold The Video Of Us As Porn

  • censoredBABbabylon daydreamersBAB-027BAB027bab00027
    • 2021-04-23
    119 min

    [WAAA-057]Aphrodisiac-Addled Sex - Bangin' In A Shared Room - Creampie Orgies Hana Himesaki

  • himesaki hana censoredcreampiebig titsWAAAwanz factorywanzWAAA-057WAAA057waaa00057
    • 2021-04-30
    42 min

    FC2PPV 1794755 [500pt] Of course the latest work is also a special sale price ♪ 3P live delivery sex with the most popular sex girl with D cup beautiful breasts ♪ Facial cumshots and bukkake 3 barrage at the end of W blowjob hard insertion!

  • amateur uncensoredfc2
    • 2021-05-01
    233 min

    [ZMAR-041]Complete! Chisato Shoda 2

  • shota chisato censoredbig titsmature womanZMARplanet plusthe whole damn thingZMAR-041ZMAR041h-237zmar00041
    • 2021-05-05
    56 min

    FC2PPV 1803102 GW limited 1000 yen discount ★ Regular price as soon as it runs out ★ I want you to do it again … Refrain from events one after another! !! I want you to see my cosplay and H body ★ Part 1

  • amateur uncensoredfc2
    • 2021-06-04
    86 min

    [ETQR-243](Breaking In POV) Married Woman Wants To Get Knocked Up By A Massive Cock Karina, Age 33

  • censoredcreampiemarried womanETQRerotic timeETQR-243ETQR243etqr00243
    • 2021-06-04
    186 min

    [HUNTB-026]"Deeper! Harder! Make Me Forget Everything!" Young Wife Gives In To Self-Destructive, Adulterous Pleasure And Rides Another Man's Dick To Paradise!

  • censoredcreampieHUNTBhuntervolvo nakanohhh groupHUNTB-026HUNTB026huntb00026
    • 2021-06-11
    140 min

    [JUFE-298]My Mom Got Remarried So Now I Have A New Stepfather, And I Hate His Guts, But He Keeps On Going Behind Her Back And Licking And Fucking Me Over And Over Again Until I Have Lost All Hope ... Mei Satsuki

  • satsuki mei censoredschoolgirldeepthroatJUFEfitchJUFE-298JUFE298jufe00298
    • 2021-06-23
    112 min

    459TEN-021 [Whip whip! !! ] Assault on the home of the Hcup gal captured in Ikebukuro! !! Bombshell fuck with a special game underwear for gals! !! "I was molested for the first time in 5th grade" Dirty little GAL who has evolved into a plump

  • hbody censoredcreampiebig titstenten-021ten021459ten-021
    • 2021-07-09
    39 min

    FC2PPV 1906813 [No] [Limited to 100 pieces, 2980 → OFF to 1480pt!] F-cup female announcer beauty with great response! Dirty vulgar sex with an elegant face ♥ ️ * Review benefits / High quality Ver

  • amateur uncensoredfc2
    • 2021-07-14
    148 min

    [SSIS-123]My Little Temptress Of A Therapist Flashes Me With Her Miniskirt While Feigning Innocence: Sublime Teasing At The Lip Salon - Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsingle workSSISs1 no 1 stylehirokoji osakiSSIS-123SSIS123ssis00123
    • 2021-07-18
    134 min

    [AGAV-059]

  • miona hori censoredsingle workbukkakeAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-059AGAV059agav00059
    • 2021-07-18
    74 min

    300NTK-607 W Boyne 4p! !! Two Super-Incarnation-Class Beautiful Girls Jd Are Disturbed In The Usual Pool! !! Drink And Make Noise, Continuous Squeezing By The Pool Without A Social Distance Or Con Dome! !! Wet Condition Of Water Level Rise With Under

  • gjdsex censoredcreampiebig titsntkntk-607ntk607300ntk-607
    • 2021-07-29
    74 min

    FC2PPV 1945219 A 10-Year-Old Girl Until 3 Days Ago. She Changed Completely From Her Expression With Sorrow. She Thrusts Her Cock Into Her Throat And Her Full Erection Is Inevitable. Sex Seeded On An Immature Body That Was Used As An Outlet For Uncle&

  • amateur uncensoredfc2
    • 2021-08-07
    112 min

    [XRL-017]A Currently Active College Girl With A Standard Deviation Score Of Over 80 Has Amazing Hand, Foot, And Ass Technique!! Mao Watanabe

  • mao watanabe censoredsluthandjobXRLk m producereal real worksXRL-017XRL017xrl00017
    • 2021-09-04
    123 min

    [BIJN-206]The Documenting Of Full Climax Of A Cute Little Devil Wife Jerking And Screaming While Cumming Madly Mitsuki Nagisa

  • scooping censoredcreampiesingle workBIJNbijin majoBIJN-206BIJN206bijn00206
    • 2021-09-11
    170 min

    [MKMP-415]夜を使いはたして、朝陽が昇るまで渚みつきにひたすら犯●れ続けたい。

  • scooping censoredcreampieslutMKMPk m producesamoarimillionMKMP-415MKMP415mkmp00415
    • 2021-09-20
    78 min

    FC2PPV 2228391 Super Popular "Hatsumi Saki" Uncensored Raw Vaginal Cum Shot Outflow 16 / Silent Support ● Sober Daughter First Part (Uniform, Shaving, Shaved, Raw Vaginal Cum Shot, Cum Swallowing)

  • amateur uncensoredfc2
    • 2021-09-23
    112 min

    [SPRD-1465]So Much Better Than My Husband... Rina Takakura

  • rina takakura censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1465SPRD146518sprd01465
    • 2021-09-23
    21 min

    FC2PPV 2237019 [Face Exposure] Slender Fair-Skinned Neat Wife. Call Her Friend And Force Multiple People To Commit In A Public Toilet. We Are Distributing 3p Video Of Face Exposure As A Privilege. (2 Works Total 84 Minutes)

  • amateur uncensoredfc2
    • 2021-10-04
    70 min

    328HMDN-413 [Piano Lecturer] Keiko Married Woman 39 Years Old A Neat Wife Climaxes With Delight At The Cock For The First Time In 5 Years. Sex Pickled Creampie Gonzo [Personal Shooting] (Yumi Sakurai)

  • amateur censoredcreampiemarried womanhmdnhmdn-413hmdn413328hmdn-413
    • 2021-10-08
    120 min

    [NGOD-156]I Get To Spend 3 Days, 2 Nights With A Young, Beautiful Slut Step-aunt (Fakecest) For Sexy Pranks That Leaves Not One Drop Of Cum Left. Miho Tono

  • miho tsuno censoredbig titsslutNGODjet eizougroupNGOD-156NGOD156ngod00156
    • 2021-10-10
    108 min

    [HSM-033]A Horny Bitch Who Loves To Have Sex! A Half-Japanese Cross-Dressing Gal Alice Takizawa 20 Years Old His/Her Adult Video Debut

  • censoredbig titsamateurHSMhime styleHSM-033HSM03359hsm00033



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored