daydreamers




FC2ABWDTTBBANRBDHNDATIDMARAGVHPPPDWAAACESDSQTEMIAAAMBIDASDPREDKBINGODEBODMIDV

2020-11-13
161 min

[MKMP-364]Reverse NTR: Household Destruction Drama: The Girl In The Apartment Next Door Is Porn Actress Kurea Hasumi : Her Expert Fucking SK**ls Have Me Completely Entranced And Have Destroyed Our Newlywed Bliss.

  • hasumi claire kuraki bookmark censoredbig titsslutMKMPk m producesasaki uzumakimillionMKMP-364MKMP36484mkmp00364
    • 2020-11-14
    65 min

    Caribbeancom 111420-001 The Soul Of Actress: God Responds To Any Punishment Ryu Enami

  • ryu enami uncensoredcreampiebukkakecaribbeancom
    • 2020-11-19
    119 min

    [BLK-478]"Looking For Someone To Let Me Give Them A Massage" The Cocky Gal Who Responded To My Ad Gets An Aphrodisiac Massage And As She's Already Cumming I Take The Opportunity To Fuck Her And Give Her A Creampie!

  • censoredcreampiesquirtingBLKkira kirakira kira black galBLK-478BLK478blk00478
    • 2020-11-22
    16 min

    KSTC-013 Natsuki-san

  • amateur censoredamateurbeautiful girlkstckstc-013kstc013kstc-013
    • 2020-11-28
    159 min

    [JUFE-231]Snake Tongue Titty Fuck Servant Training Droopy Tits Finding Out A Hostess Princess' Weakness, We Fuck At A Hotel Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsJUFEfitchJUFE-231JUFE231jufe00231
    • 2020-12-04
    240 min

    [SOUD-016]Athletic Girls Getting Fucked Wearing Their Sweaty Uniforms, Their Fit, Tight Pussies Expertly Milking Every Drop Of Semen!!

  • censoredamateurcosplaySOUDprestigebest fuckingSOUD-016SOUD016118soud00016
    • 2020-12-05
    118 min

    [JUL-390]Ex-Swimsuit Model Married Woman: Exclusive MILFs Volume 3!! A Night Alone Together With My Hot Sister-In-Law During A Blackout... Mizuho Aoyama

  • mizuho aoyama censoredbig titsmature womanJULmadonnashiro shotenJUL-390JUL390jul00390
    • 2020-12-08
    35 min

    FC2PPV 1598915 [Individual shooting] Nana who is neat and clean with a model and a vaginal cum shot

  • amateur uncensoredfc2
    • 2020-12-11
    123 min

    [DIC-080]Under 5' Tall! Busty G-Cup Voice Actress Hina Shinjo's Porn Debut! Prim, Pretty G-Cup! Real Anime Body

  • hina shinjo censoredbig titssingle workDICprestigekyohei nemuridiscoverDIC-080DIC080118dic00080
    • 2020-12-12
    120 min

    [IPX-588]Super Fellatio SP When Minami Sucks Cock It Feels Better Than Her Vagina Minami Aizawa

  • minami aizawa censoredblowjobslutIPXidea pocketinaballdishIPX-588IPX588ipx00588
    • 2020-12-15
    137 min

    [KUSE-003]Chan Yota (25) Acme X Sexercise

  • chanyota censoredsingle workKUSEsod createanzothis actress style is amazingKUSE-003KUSE0031kuse00003
    • 2020-12-20
    144 min

    [HND-919]I'm Just A Country Girl, But Can I Become An Adult Video Actress？ This Town In Miyazaki Has A Population Of 2000, And Now She's Here In Tokyo To Make Her Adult Video Debut Riko Shinohara

  • riko shinohara censoredcreampiebeautiful girlHNDhon nakatiger kosakaiHND-919HND919hnd00919
    • 2020-12-26
    73 min

    H4610 ki201226 Rrquest

  • amateur uncensoredh4610
    • 2021-01-09
    157 min

    [IPX-591]Let's Hurry Up, Get Naked, And Fuck, Okay？" Whether A****p Or Awake, She's Always French Kissing A Virtual Fuck Fest Love Life Together A Lovey-Dovey Couple Iyona Fujii

  • iyo fujii censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-591IPX591ipx00591
    • 2021-01-12
    137 min

    [FONE-131]Assistance @ Secret Account. Homecoming Dotcom #Akari #Gunma Life #Small Tits Soft Woman

  • censoredcreampieschoolgirlFONEfirst starplus first starFONE-131FONE131h-491fone00131
    • 2021-01-15
    127 min

    [YMDD-218]Beautiful Hostess At A Hot Spring Hotel Lavishes Your Whole Body With Her Tongue - Creampie Sex Included Yu Shinoda

  • shinoda yu censoredcreampiebig titsYMDDmomotaro video publishinghimrockyoung peachYMDD-218YMDD218ymdd00218
    • 2021-01-17
    114 min

    [SUJI-127]Young Shave Pussy, Bringing Her Home And Fucking Her

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-127SUJI127suji00127
    • 2021-02-04
    70 min

    435MFC-078 [Shiroto Gonzo] Almost a virgin (one experience) Gonzo with a slender female college student! !! / MIZUKI / 19 years old / B cup (small breasts)

  • mizuki censoredamateurcosplaymfcmfc-078mfc078435mfc-078
    • 2021-02-05
    57 min

    396BIG-071 Sakura (26)

  • amateur censoredcreampiebig titsbigbig-071big071396big-071
    • 2021-03-05
    83 min

    396BIG-096 Nako & Saya Parents and Daughters

  • amateur censoredcreampiemarried womanbigbig-096big096396big-096
    • 2021-03-06
    234 min

    [HUNTA-962]"I Want You To Defile My Wife" I Went Away On Business On Purpose So That My Wife Could Get Breaking In Training From Another Man, And As I Was Peeping On Her, She Showed Me Facial Orgasmic Expressions That She Would Never Show To

  • censoredHUNTAhunterkawajirihhh groupHUNTA-962HUNTA962hunta00962
    • 2021-03-15
    70 min

    491TKWA-163 Brown Half J ○ With Outstanding Style And Raw Creampie Video

  • amateur censoredcreampiebig titstkwatkwa-163tkwa163491tkwa-163
    • 2021-03-21
    60 min

    413INST-106 After all raw feels good! Swimming club JD Maina-chan (20) who is addicted to sex without rubber If the nipple is too weak and cramped, it will be intensely iki vagina Kyun convulsions stop )

  • amateur censoredcreampieamateurinstinst-106inst106413inst-106
    • 2021-03-21
    159 min

    [JUL-510]20 Years Old, G-Cup Titties, A Mother Of Two C***dren. Aika-san Her Adult Video Debut!!

  • censoredbig titsmomJULmadonnamametaro mamezawaJUL-510JUL510jul00510
    • 2021-04-03
    242 min

    [MMB-356]10 Genuinely Degenerate Housewives Who Were Fooled On April Fools Day And Got Creampie Fucked - Please Don't Make A Fool Out Of Me! You Sexy Housewives! -

  • censoredcreampieMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-356MMB356mmb00356
    • 2021-05-07
    160 min

    [MIRD-212]Holy Water Harem - Four Beautiful Girls Piss To Make You Cum Buckets! Mikako Abe Noa Eikawa Rei Kuruki Mitsuki Nagisa

  • abe mikako sakaegawa noa censoredsquirtingbeautiful girlMIRDmoodyznao masakimoodyz realMIRD-212MIRD212mird00212
    • 2021-05-20
    109 min

    [KIR-034]A Married Woman Massage Master Aya Shiomi

  • aya shiomi censoreduniformsingle workKIRstar paradisekirei star paradiseKIR-034KIR034h-254kir00034
    • 2021-05-20
    93 min

    [OKB-112]Hina Kawai A Voluptuous Big Ass A Goddess In Bloomers We Dressed A Lolita Beautiful Girl And A Chubby Girl In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy Hairs Were Poking Out For S

  • haruna kawai censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-112OKB1121okb00112
    • 2021-05-20
    121 min

    [DLDSS-006]Step Mother Lover My Incredible Step Mom Craves Me Every Day Ayaka Tomoda

  • ayaka tomoda censoredcreampiesingle workDLDSSdahliapassionate employeeDLDSS-006DLDSS0061dldss00006
    • 2021-05-28
    153 min

    [MIFD-159]Amateur 20 Year Old I'm Having A Hard Time Being True To Myself Porn Debut Yuika Aoi

  • yuka aoi censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-159MIFD159mifd00159
    • 2021-06-01
    56 min

    484SDC-001 Famous Cosplayer Pacoloke Shooting 153cm Little To ○ -chan

  • amateur censoredamateurcosplaysdcsdc-001sdc001484sdc-001
    • 2021-06-10
    107 min

    [XMOM-032]Newly-wed Wife - Just One Week After Her Wedding She Tastes Another Man's Dick. Ameri Hoshi

  • star ameri censoredmarried womanmature womanXMOMcenter villagemurakipink breathXMOM-032XMOM032h-086xmom00032
    • 2021-06-11
    178 min

    [DASD-872]Dual Special - The Ultimate Three-Some Harem Starring A Super Cute Transsexual Duo Sara Aizawa Rui Nanase

  • aizawa sara nanase rui censoredbeautiful girlDASDdasnao masakiDASD-872DASD872dasd00872
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-25
    171 min

    [DOMI-001]A Life in Adoration of a Giant Female. Chitose Yuki.

  • chitose in the evening censoredbig titssingle workDOMImaguro honpokoubunridoronikuatsu shihaiDOMI-001DOMI001h-1441domi00001
    • 2021-07-05
    114 min

    FC2PPV 1905923 Active gravure / H cup 2 people * Limited quantity *

  • amateur uncensoredfc2
    • 2021-07-06
    86 min

    493NAEN-076 Raw! ？？ Matching app girls ○ students! ？？ Stir a young hole with a big cock and make a demon squid & mass cum shot ring Nico

  • amateur censoredamateurbeautiful girlnaennaen-076naen076493naen-076
    • 2021-07-07
    285 min

    [258DOKS-540]満員電車で接吻挑発、発情素股されちゃって・・・ ベスト 17名の電車猥褻映像 さくらみゆき 山川ゆな 愛里るい 君色花音 矢澤美々

  • amateur censoredamateurslutdoksdoks-540doks540258doks-540
    • 2021-07-09
    75 min

    328HMDN-380 Shocking [Brood Parasite] Slender Beautiful Wife 35 Years Old SNS ＃ SEX Cum Shot Raw Sperm Donation Wife. Continuous seeding Ahe fell without pulling out to the powerful SEX of the unequaled cock younger than her husband.

  • amateur censoredcreampiemarried womanhmdnhmdn-380hmdn380328hmdn-380
    • 2021-07-29
    87 min

    435MFC-128 [Advocacy Body That You Want To Protect] Excited By The Fair-Skinned Slender Saffle And The First Gonzo! All-You-Can-Eat With Vaginal Cum Shot Sex And Cosplay Sex To Commemorate The Virginity Of Gonzo! [Shiroto Gonzo ＃ Rei ＃ 23 Years Old ＃

  • amateur censoredcreampieamateurmfcmfc-128mfc128435mfc-128
    • 2021-08-09
    56 min

    FC2PPV 1976754 Celebrities Like Raw ♡] Beautiful Breasts Nice Ass Perfect Body Natural Cosmetics Brand Female President Wife Gan Butt Fuck Ass Pururun Gachi Acme Organic Sperm Seeding Creampie Fxxk

  • amateur uncensoredfc2
    • 2021-08-13
    189 min

    [HUNTB-085]"Well, The Two Of You Seemed So Happy ..." Horny Nurse After Nurse, Engaged In Irreversibly Damaging Reverse NTR Filthy Sex! I Went To Be With My Wife In The Hospital During Her Pregnancy, When I Met All These Beautiful Nurses ...

  • censoredcreampieuniformHUNTBhunterkawajirihhh groupHUNTB-085HUNTB085huntb00085
    • 2021-08-16
    67 min

    328HMDN-393 [I Hate It, But I Want To See It! ] Former Weather Older Sister Wife 26 Years Old Sns ＃ Wife Who Came By Sperm Donation Grabbed The Ribs And Continuously Vaginal Cum Shot. Convulsions Died Many Times To Crush The Uterus Of The Unequaled C

  • amateur censoredcreampiemarried womanhmdnhmdn-393hmdn393328hmdn-393
    • 2021-08-21
    149 min

    [KATU-087]Colossal Tits x Huge Ass x Slut: Picking Up Super Lewd Wives - Gals In Miniskirts With Their Asses Sticking Out Are Super Horny!

  • censoredbig titsslutKATUkatsuo butsusan mousouzokumaglowKATU-087KATU087katu00087
    • 2021-09-01
    135 min

    [NACR-461]A Poor College S*****t In Her 20s: A Document Showing Her Losing Her Virginity - Iori

  • censoredbig titsNACRplanet plusdirector oshichi ku ryuuNACR-461NACR461h-237nacr00461
    • 2021-09-03
    43 min

    FC2PPV 2132315 * Limited [Clothing Fucking Pinch] Jcup Gravure-Class Plump Body Aspiring To Be A Voice Actor! Fucking 2 Pinched While Being Gently Blamed With A Soothing Moe Voice!

  • amateur uncensoredfc2
    • 2021-09-18
    129 min

    [MGMQ-080]I Want This Beautiful Big Tits Little Devil Girlfriend To Anal Fuck Me, Anytime, Anywhere, All The Time. Hazuki Wakamiya

  • wakamiya censoredanalblowjobMGMQmegamibijo shin queenMGMQ-080MGMQ080mgmq00080
    • 2021-10-08
    211 min

    [HUNTB-117]Cleaning -Shota Kitano-

  • censoredblowjobsisterHUNTBhunterkonnyaku kannohhh groupHUNTB-117HUNTB117huntb00117
    • 2021-10-15
    56 min

    FC2PPV 2345920 * Until 10/17 3980⇒2980 ★ First Shot ☆ Small Breasts Slender Beauty ♥ Cool Beauty Manyi-Chan 22 Years Old ☆ Man Juice Cod To Blame Electric Massage! ♥ Cool But The Dick Is Wet And Wet Lust Cum Shot Ejaculation ♥ * With Benefits

  • amateur uncensoredfc2
    • 2021-10-21
    101 min

    [REBD-596]Aika 2 - The White Dancing Princess Of The Ryukyus - Aika Yamagishi

  • aika yamagishi censoredsingle workREBDrebeccakawaREBD-596REBD596h-346rebd00596
    • 2021-10-22
    175 min

    [SSIS-211]You"re At A Whore House, And One Of Japan"s Top Pornstars Appears Right In Front Of You! Do You Fuck Her Or Fuck Off？ ？ Yua Mikami

  • yua mikami censoredbig titssingle workSSISs1 no 1 styletake dSSIS-211SSIS211ssis00211
    • 2021-10-24
    54 min

    FC2PPV 2369213 [Fc2 Shot] Appearance! Amateur Female College Student [Limited] Aspiring Female Announcer ☆ Beautiful 21-Year-Old Miku Neat Sister! Enjoy Train Lovers, Smart Women, And Purely Intelligent Women! !! I Still Dig Up The Shame Of The Beaut

  • amateur uncensoredfc2
    • 2021-10-29
    104 min

    [NNPJ-477]Saw An Amazing Girl At The Night Pool, E-Cup Swimsuit Gal Who Talks With Young Slang "OMG, No Way! Picking Up Girls Is So Old School LOL." Went Straight To The Room And Fucked The College Girl Raw. Sassy E-Cup College Girl Sanapi

  • censoredcreampieNNPJnampa japanNNPJ-477NNPJ477nnpj00477
    • 2021-10-30
    135 min

    [NKD-282]Perversion, Pleasure, Moaning and Groaning. Sex Toys, Instinct. A Slutty Female Office Worker. On a Double Bed in a Hotel Room.

  • censoredNKDnakashima kougyouNKD-282NKD282nkd00282
    • 2021-11-05
    114 min

    [LOL-203]A L*lita Specialty A Barely Legal Discovery! We"ve Finally Captured A Shaved Pussy Lolita! Lala-chan 144cm Lala Kudo

  • lara kudo censoredcreampieblowjobLOLglayzrori senkaLOL-203LOL20312lol00203
    • 2021-11-06
    137 min

    [CEAD-377]Pervert At Night! 2 Chisato Shoda Legendary Mature Women Are Too Lewd To Have Sex At Night!

  • shota chisato censoredcreampiebig titsCEADserebu no tomoCEAD-377CEAD377cead00377



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored