drugs




FC2STARSSDABSSISGVHPPPDNACXCJODHMNRBDEBODAVSADASDMILKAWDFSDSSWAAACAWDHODVNNPJKBI

2020-12-25
120 min

[IBW-810]Short And Totally Wet: Obscenity In A S*****t Bus Stopped Because Of The Rain

  • kanon urara tenno uta censoredbeautiful girlIBWi b worksIBW-810IBW810
    • 2021-01-14
    133 min

    [SPRD-1365]Mothers in Law Want To Get Pregnant, Too. Iroha Narumiya

  • narumiya iroha censoredcreampiemature womanSPRDtakara eizohotate ikkanaleddinSPRD-1365SPRD136518sprd01365
    • 2021-01-22
    63 min

    [DHT-197]Picking Up First-Rate MILFs - Beautiful Mature Creampie Sex JAPAN - Ms Kasumi, Age 41

  • censoredmarried womanamateurDHThot entertainmentstudio zeroDHT-197DHT19759dht00197
    • 2021-01-29
    42 min

    [moj-006]おとは

  • amateur censoredcreampiebig titsmojmoj-006moj006moj-006
    • 2021-01-30
    68 min

    326KNTR-002 [Cuckold Immediately NN Bulletin] A metamorphosis gal who is jealous and estrus cums many times with an actor Ji Po ☆ I am crazy with an unfaithful act begging for pregnancy juice! !!

  • amateur censoredcreampieamateurkntrkntr-002kntr002326kntr-002
    • 2021-01-31
    46 min

    493PKPD-087 [Leaked] Deceive the boyfriend’s JD and make a big vaginal cum shot without rubber

  • amateur censoredcreampieamateurpkpdpkpd-087pkpd087493pkpd-087
    • 2021-01-31
    239 min

    [XVSR-577]Spoiled Wives' Baby-Making Creampie Sex Lives - Best Selection

  • yui hatano otsuki sound censoredcreampieXVSRmax amax ikacalenXVSR-577XVSR577xvsr00577
    • 2021-02-01
    69 min

    [MBRAA-188]四ノ宮ななみ 恋糸ラプソディ

  • shinomiya nanami censoredsoloworkMBRAAspice visualMBRAA-188MBRAA188
    • 2021-02-02
    31 min

    475SKCK-020 Kaname 2

  • amateur censoredanalamateurskckskck-020skck020475skck-020
    • 2021-02-03
    61 min

    SIRO-4377 [First shot] [Beautiful office lady of a major company] [Doggy style with a sly face ..] A video of a slender OL with a beautiful appearance. Pleasure does not stop at the piston that becomes intense in the second half .. AV application on

  • amateur censoredamateursirosiro-4377siro4377siro-4377
    • 2021-02-16
    32 min

    FC2PPV 1688083 * For some reason, the sample hides the face. [4K] Main story appearance [Individual shooting] Private ordinary course FJK Delicate but raw insertion into a super baby-faced girl with E cup big breasts Gonzo w Hidden shooting → Natural

  • amateur uncensoredfc2
    • 2021-02-17
    65 min

    FC2PPV 1688037 [Problem work] Time stops from the beginning! Doujin original! All you want to do because it doesn’t move, if the ww time that you’ve been seeding your dreams moves, you’ll be pregnant with the rich sperm of a former vir

  • amateur uncensoredfc2
    • 2021-02-23
    133 min

    [STARS-329]Shared Room NTR After Filming This Elder Sister Type Weather Girl Was Unable To Get Back To Tokyo After Being Caught In A Snowstorm, So She Spent The Entire Night With The Fresh Face Assistant Director Who Always Listens To Her Bitch About

  • mahiro yui censoredcreampiesingle workSTARSsod createbungo maedasod starSTARS-329STARS3291stars00329
    • 2021-02-27
    66 min

    H0930 ki210228 Sakiko Shimizu 31years old

  • amateur uncensoredh0930
    • 2021-03-03
    120 min

    [PFES-015]Lying In Wait Sweaty At-Home Lessons The Vulnerable Personal Trainer Risa Hasegawa

  • risa hasegawa censoredbig titssingle workPFESdaschinpo dazaisummer panties festivalPFES-015PFES015pfes00015
    • 2021-03-10
    48 min

    FC2PPV 1720869 [Former Virgin-kun x Fluffy G Lori] First Shooting, Titty Fuck, Former Virgin-kun Creampie Dreams! Breast swaying and vaginal cum shot with G fucking back as close as possible to H! The sensitivity is too high and it rolls up! Pant voi

  • amateur uncensoredfc2
    • 2021-03-11
    49 min

    [orec-712]まなみ 4

  • amateur censoredcreampiebig titsorecorec-712orec712orec-712
    • 2021-03-12
    47 min

    FC2PPV 1686765 First shot ❤️ Former reader model Shiori Ito 26 years old ❤️ There is a purchase privilege with two singles recruited on Twitter and a nasty orgy

  • amateur uncensoredfc2
    • 2021-03-18
    47 min

    285ENDX-334 A beauty member beauty who has turned on the erotic switch when impatient! Blow face erotic Sugi Tagenpaku!

  • amateur censoredcreampiebig titsendxendx-334endx334285endx-334
    • 2021-03-21
    120 min

    [JUL-511]I Returned Home To My Big Stepsister's Tempting, Sweaty, Creampie Impregnation Fuck Fest Jun Harumi

  • jun shunmei censoredcreampiemature womanJULmadonnakitorune kawaguchiJUL-511JUL511jul00511
    • 2021-03-24
    60 min

    494SIKA-068 Stupid Furari Yankee Daughter And Nico Nico Creampie SEX

  • amateur censoredcreampieschoolgirlsikasika-068sika068494sika-068
    • 2021-04-12
    57 min

    FC2PPV 1766330 [Personal shooting] A married woman who is violated by another stick while her husband is on a business trip [Uncensored]

  • amateur uncensoredfc2
    • 2021-04-12
    115 min

    [083PPP-2116]ヤンキー美人ベスト10コンピ 1 HD

  • amateur censoredamateurpppppp-2116ppp2116083ppp-2116
    • 2021-04-13
    60 min

    299EWDX-354 A slender beautiful wife who is a reading model is friendly and likes SEX!

  • amateur censoredcreampiemarried womanewdxewdx-354ewdx354299ewdx-354
    • 2021-04-22
    106 min

    [SPRD-1404]Stepmom/Stepson Creampies - The First Time She Took His Creampie Sumire Mihara

  • mihara sumire censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1404SPRD140418sprd01404
    • 2021-04-24
    127 min

    [KTKC-114](Upload) Charismatic Pick Up Artist Who Loves Big Tits Reveals The Amateur Girl Who Turned Him On The Most Saki (Estimated G-Cup)

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-114KTKC114ktkc00114
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    190 min

    [HUNTA-999]I Was Bathing Alone In A Coed Hot Spring Resort Bath, When Suddenly A Bunch Of Big Tits Young Wife Babes From A Town Hall Association Came Charging In Off Of Their Tour Bus! I Felt Uncomfortable And Tried To Leave, When This Big Tits Young

  • censoredbig titsmarried womanHUNTAhunterkawajirihhh groupHUNTA-999HUNTA999hunta00999
    • 2021-05-02
    130 min

    [SORA-309]Personality Manipulation Brainwashing H*******m Evolution Into A Noble B***dline! Quality And Beauty Is The Original H*******m Version Miki Sunohara

  • future sunohara censoredsingle workdramaSORAyama to sorayosukeSORA-309SORA309sora00309
    • 2021-05-07
    16 min

    10musume 050721_01 Pussy Collection: Please look at Riko’s pussy Riko Sawamura

  • amateur uncensored10musume
    • 2021-05-11
    135 min

    [SDDE-647]"What Kind Of Soup Shall I Make For You Today, Sir？" Piss, Sweat Pussy Juice... Busty Maid Offers Her Own Body Fluids To Her Employer - Welcome To The Popular Maid Cafe "Fluffy White Delights"!

  • sachiko nene tanaka censoredSDDEsod createkurenai katosenzSDDE-647SDDE6471sdde00647
    • 2021-05-14
    240 min

    [SKMJ-165]If You Can Resist The Good Looking AV Actor's Super Sex Techniques You Get 1 Million Yen! If You Cum, Get Ready For A Merciless Quick And Fast Pounding With A Raw Creampie! College Girls Around The Town Faint From Massive Pleasure Sprea

  • censoredcreampiebig titsSKMJred face girlone topSKMJ-165SKMJ165h-1324skmj00165
    • 2021-05-21
    119 min

    [JUL-589]Strange People Flock To Me, A Part-time Worker. A Suburban Love Hotel Turns Into A Hangout For Perverts. Rin Ogawa

  • rin okae censoredbig titsmature womanJULmadonnahiroyuki kimuraJUL-589JUL589jul00589
    • 2021-05-22
    121 min

    [NSPS-994]She Was Annoying Me So I Fucked Her Wife Gets Soaked Rika Aimi

  • rumi tadami censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-994NSPS994nsps00994
    • 2021-05-28
    42 min

    480FRIN-034 Atami Ryokan User Couple Secretly Hidden Camera [Libido Satisfaction Wife H Cup 27 Years Old]

  • amateur censoredcreampiebig titsfrinfrin-034frin034480frin-034
    • 2021-06-04
    77 min

    FC2PPV 1853078 [3480 → Limited number 2480] Excavation of the highest ranked 18-year-old transcendental beauty ❤️ Jie K Urgent release after graduation ❤️ Beautiful girl who works at a flower shop and dreams of opening ❤️ Inserts the second cock in h

  • amateur uncensoredfc2
    • 2021-06-05
    64 min

    H4610 ki210606 Miu Shinohara 31years old

  • amateur uncensoredh4610
    • 2021-06-17
    180 min

    [ABW-106]中出し やりたい放題 9 結城るみな 【MGSだけのおまけ映像付き 15分】

  • amateur censoredcreampieamateurabwabw-106abw106abw-106
    • 2021-06-20
    240 min

    [SUPA-586]30-Barrage Irresponsible Creampies On A S-Class Beauty You Just Met!! BEST

  • censoredcreampiebig titsSUPAclass s amateurtaro kSUPA-586SUPA586supa00586
    • 2021-07-02
    121 min

    [HODV-21587]I'll Tease Your Nipples All Night Long Hana Shirato

  • white peach censoredbeautiful girlslutHODVh m pk c takedaHODV-21587HODV215875642hodv21587
    • 2021-07-09
    29 min

    FC2PPV 1913146 Hana-chan! A student virgin who has never done more than a kiss! Virgin guidance by an older sister with cum

  • amateur uncensoredfc2
    • 2021-07-22
    172 min

    [JUFE-315]Bondage Suite Room Two Gorgeous Sluts Ravish Men And Drive Them Crazy Toka Rinne Yuria Satomi

  • roaring sound satomi yuria censoredbig titsslutJUFEfitchaida yumenoJUFE-315JUFE315jufe00315
    • 2021-09-18
    121 min

    [ZOCM-004]Complete POV. Plain Ordinary Married Woman With A Hot Body Has Unforgettable Time With A Guy"s Huge Dick. Colossal Tits And Huge Ass On A Submissive Sex Pet. 100cm J-cup Nanami-san Enjoys Huge Dick NTR. Nanami Matsumoto

  • nana matsumoto censoredcreampiebig titsZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-004ZOCM004zocm00004
    • 2021-09-24
    125 min

    [CLDG-009]The Miracle I-cup Godly Tits Of This C***dcare Worker - Chizuru Shiina

  • chizuru shiina censoredcreampiebig titsCLDGtoyohikotoyohikotoyohiko kikakuCLDG-009CLDG009cldg00009
    • 2021-10-01
    154 min

    [CAWD-295]Nanami Shiozaki Gets Devilishly Horny! She Gets So Worked Up That She Squirts All Over Herself With Wetness! Creampie Cumming Is Permitted! Heavy Pounding And Intense Fucking! Nanami Shiozaki

  • nanami shiozaki censoredcreampiesquirtingCAWDkawaiimaeda bungouCAWD-295CAWD295cawd00295
    • 2021-10-09
    128 min

    [XRL-026]Breeding With A Servant In A Dog Collar: Obscene Deep Throat Breaking In With A Sobbing Mare 2

  • reika ochiai madoka mizuno censoreddeepthroatXRLk m producereal real worksXRL-026XRL026xrl00026
    • 2021-10-15
    153 min

    [BLK-527]Convenient Free Pussy! Fucking Raw Till Morning With A Horny Bitch Who Loves Older Men 08

  • censoredcreampiesquirtingBLKkira kirakira hosi kira black galBLK-527BLK527blk00527
    • 2021-10-18
    76 min

    530DG-016 ＃ 04 Female College Students Who Are Abandoned On The Emergency Stairs Of The Building At The New Welcome Party And Fall Asleep

  • amateur censoredcreampiebig titsdgdg-016dg016530dg-016
    • 2021-10-19
    58 min

    Caribbeancom 101921-001 Luxury Adult Healing Spa: There Is Nothing Better Than Slow Passionate Sex Yuna Sasaki

  • yuna sasaki uncensoredcreampiecaribbeancom
    • 2021-10-21
    55 min

    SIRO-4672 [First Shot] [Small Animal Girl] [Young Beautiful Skin] A Cosmetology Student With A Friendly And Lovely Smile. With The Rushing Pleasure, Gradually Change The Smile To A Screaming Face And Announce The Climax Many Times With A High-Pitched

  • amateur censoredamateursirosiro-4672siro4672siro-4672
    • 2021-10-23
    121 min

    [JUE-003]Female Ninja, Backstab Female Ninja Embarrassment, She Falls Into Ecstatic Wonderland, Nozomi Haneda

  • nozomi haneda censoredbig titsmature womanJUEglobal media entertainmentsarjijukueiJUE-003JUE003jue00003
    • 2021-11-05
    17 min

    FC2PPV 2404666 [Weekend Limited Release] Wife’s Daytime Cheating Video Robbed From Cheating Partner: Wife Who Refuses Even If She Asks For Sex Spills A Man’s Big Cock At Home [cen]

  • amateur uncensoredfc2
    • 2021-11-05
    152 min

    [SSIS-234]Riri Nanatsumori Gets Fucked. A Documentary that Records Everything: the Dislike on Her Face and Her Fall from Grace.

  • nanatsumori riri censoredsingle workSSISs1 no 1 stylemaeda bungouSSIS-234SSIS234ssis00234
    • 2021-11-10
    42 min

    [IENFH-012]My Teenage Stepsister Took Pity On Me And Let Me Fuck Her Thighs, But Then She Got Wet And It Slipped Inside, And I Couldn"t Stop Myself From Cumming Inside Her! Yui Tenma

  • yui tenma censoredcreampieIENFHi energychrysanthemumienfIENFH-012IENFH0121ienfh00012
    • 2021-11-11
    62 min

    336KNB-180 [Female Face Of A Naive Amateur Wife] I Made A Woman With A Frustrated Married Woman Who Has Been Less Frustrated Since I Got Married W Pre-Buttocks & Cherry-Colored Nipples Are A Must-See! At Kazo Ekimae, Kazo City, Saitama Prefecture

  • amateur censoredmarried womanamateurknbknb-180knb180336knb-180
    • 2021-11-20
    240 min

    [OKAX-797]Pussy Sopping Wet With Lewd Juices! Anal Twitching Masturbation

  • hikaru minazuki nimo censoredOKAXk m produceokazuOKAX-797OKAX797okax00797



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored