fc2




FC2MARAAUKSAPODCAWDSTARSNNPJLULUIPXNGODHNDMEYDSPRDMIAAMIDVNACRHDKAHMNVENUSSNIDTT

2022-07-02
26 min

FC2PPV 3009211 Imo Nogi At The End Of The Byte! !! If You Make A Slow Blowjob In The Car With A Cute Face, You Will Be Stunned By A Great Technician … To Ejaculate In The Mouth From The Camera’S Eyes

  • amateur uncensoredfc2
    • 2022-07-02
    23 min

    FC2PPV 3010858 [Individual] A Beautiful Chara Wife Who Receives A Loan For The Money She Wants To Play With Her Gentle Husband As Her Back. A Satisfying Expression Even Though Vaginal Cum Shot Is Made To The Back Of The Vagina. ..

  • amateur uncensoredfc2
    • 2022-07-01
    58 min

    FC2PPV 2997660 [Against The New AV Law] [Uncensored] Three Months After Graduation, 10 Years Old With Marshmallow Skin Who Became An Adult ♡ Serve Deep Throating While Sobbing A Cock That Is Mercilessly Shot To The Back Of The Throat. Forcibly Vagina

  • amateur uncensoredfc2
    • 2022-07-01
    16 min

    FC2PPV 3007057 Exclusive Sale [Weekend Limited Sale] Diffusion Of Flirting Videos That Tickle The Body Of The Finest Beauty And Make You Feel Erotic. [cen]

  • amateur uncensoredfc2
    • 2022-07-01
    50 min

    FC2PPV 2939497 [Personal Shooting] Appearance "Suzuka 37 Years Old" Pheromone Munmun A Sexy Beauty Busty G Cup Married Woman Licks From Toes To Anal And Then Inserts Super Decachin Raw! → I’m Cramping And Rolling! → Massive Vaginal Cum S

  • amateur uncensoredfc2
    • 2022-07-01
    91 min

    FC2PPV 2996188 A Female College Student With A Whip Whip G Cup Secretly Approves A Vaginal Cum Shot For School Expenses! I Was A Sexually Lustful Child Who Shook My Body And Had Convulsions! 3 Creampie!

  • amateur uncensoredfc2
    • 2022-07-01
    47 min

    FC2PPV 3006635 Appearance! !! Cinema Style! [Uncensored] Limited Number! !! A 19-Year-Old Innocent And Pretty Fair-Skinned Female College Student Who Has Grown Up A Little! Creampie In A Dazzling Pure White Dress And A Beautiful Whitening Body! !!

  • amateur uncensoredfc2
    • 2022-07-01
    77 min

    FC2PPV 3006652 * Half Price Until 7/6! Completely Amateur, 21-Year-Old Half-Beautiful Girl With Exoticism, E-Cup Girl Who Is A Yoga Instructor [cen]

  • amateur uncensoredfc2
    • 2022-07-01
    47 min

    FC2PPV 3008868 [No] [Off To 1480pt Limited To 100!] Dirty Little G Cup Big Breasts Girls ♥ ️ Further Growing？ The Glamor Is Increasing And The Ass Is Also Erotic! * Review Benefits / High Image Quality Ver

  • amateur uncensoredfc2
    • 2022-07-01
    52 min

    FC2PPV 3008827 [None] [Limited Number 1480 → Off To 980pt!] Rich Sperm Mass Facial Cumshots ♥ Beautiful Ass Female College Student With Attractive Ass Anyway As A Former Gymnast ♥ Puri Puri Hips Are The Best ♥ * Review Privilege / High Quality Ver

  • amateur uncensoredfc2
    • 2022-07-01
    52 min

    FC2PPV 2982793 [Personal Shooting] Maika 25 Years Old Massive Launch To A Lewd Fair-Skinned Beauty With Outstanding Treasured Style

  • amateur uncensoredfc2
    • 2022-07-01
    59 min

    FC2PPV 3009188 [Uncensored X Personal Shooting] Car Sex With A Short Cut Beauty In The Midsummer Car Of Hell! Sweaty, Soupy And Excited! Eh! Is There Anyone !？ A Man Who Seems To Be A Vagrant Was Chewy While Observing Outside

  • amateur uncensoredfc2
    • 2022-07-01
    49 min

    FC2PPV 3008845 * Limited Quantity * [God Times] S Class! !! ☆ Over Idol ☆ Take Out A Fair-Skinned Gal (22) With A Boyfriend → Raw Sex At Home ☆ Creampie & Facial Cumshots [cen]

  • amateur uncensoredfc2
    • 2022-07-01
    66 min

    FC2PPV 2985676 [Shortcut Beautiful Breasts] Hana ★ Living In Kyushu A ● Beautiful Girl With Short Black Hair Who Longs For An Actress Is Ridiculous Beautiful Breasts! Unmaintained Man Hair Bobo Manko Piercing! [cen]

  • amateur uncensoredfc2
    • 2022-07-01
    53 min

    FC2PPV 3009465 A College Student Who Wants To Be A Voice Actor With A Cute Voice And Face. When I Thought She Was Lori Kawa, She Was A Famous Girl With Beautiful Breasts Of E Cup.

  • amateur uncensoredfc2
    • 2022-06-30
    45 min

    FC2PPV 3004090 3 Works Total 190 Minutes !! 1980 → 2980 [No / Orgy] A Funny Story Is Approached To "Toyokoki-Zu" Who Roams The Night City, And 10 Sanctions Are Vaginal Cum Shot!

  • amateur uncensoredfc2
    • 2022-06-30
    92 min

    fc2-ppv 3005472 【3P乱交】【ザーメンタンク】美容系学生(21)はマグナム師匠に淫乱性を見出され中逝き中出し3P調教の末、何度もイキまくるザーメンタンクになりました FC2-PPV-3005472

  • amateur uncensoredfc2
    • 2022-06-30
    66 min

    FC2PPV 3005237 * Limited Price [Personal Shooting] The Collapse Of Friendship ,. Real Friend Sex Of Transvestite Layer X Beauty Layer ♡ A Vivid And Intense Devouring Etch Of Two People Who Became A Relationship Between A Man And A Woman For The First

  • amateur uncensoredfc2
    • 2022-06-30
    90 min

    FC2PPV 2999719 [Breaking News] June Closing Is [Rare Erotic] Premium Beauty With Overwhelming Style! !! Geki Erotic Kawa-Chan Former Age ○ Model Bomb! !! !! !!

  • amateur uncensoredfc2
    • 2022-06-30
    63 min

    FC2PPV 3006097 [Appearance] [No Model] Blow Job, Gonzo, Facial Cumshot At The End Of The Pink Ma-Ko Big Opening Book & Squeezing Of The Idol Class Kawa Daughter Who Is A Dental Hygienist! [Playback Time → 1 Hour 1 Minute 59 Seconds]

  • amateur uncensoredfc2
    • 2022-06-30
    63 min

    FC2PPV 2986131 [Big Breasts Idols] Yui (22) Big Breasts H Cup Fledgling Idols. Gonzo With The Promise Of Wearing A Mask! Boyfriend H Is Exploding Super Frustration With Protein. I Played Down My Dirty Little Boobs Girl [Extraordinary Face Disclosure]

  • amateur uncensoredfc2
    • 2022-06-30
    39 min

    FC2PPV 3004129 Limited To 7/7 [Face Exposure, Uncensored] Super Cute With A Baby Face! !! Don Pisha Is Irresistible For Those Who Like Minimum Loli! Plenty Of Intriguing Vaginal Cum Shot! !!

  • amateur uncensoredfc2
    • 2022-06-30
    16 min

    FC2PPV 3004674 * Only The Remaining Stock * [G Cup CA] Creampie Without Going To Work. CA That Delayed The Flight To Okinawa. [cen]

  • amateur uncensoredfc2
    • 2022-06-30
    104 min

    FC2PPV 3005077 [Personal Shooting / Set Sale] "The Taste Of Other Sticks Was Exceptional …" The Secret Of The 34-Year-Old Wife Continues ① & ②

  • amateur uncensoredfc2
    • 2022-06-30
    55 min

    FC2PPV 2994891 [Personal Shooting] Continued, Famous Department Store In Tokyo ★ Superb G Cup Beauty Depaga And Raw Vaginal Cum Shot Sex ②

  • amateur uncensoredfc2
    • 2022-06-29
    154 min

    FC2PPV 2995423 [Waseda University Graduate] -Limited- [cen]

  • amateur uncensoredfc2
    • 2022-06-29
    91 min

    FC2PPV 3003951 [9980 ⇒ Today’s Limited 90 Off] Former Student Council President Who Is Too Erotic In The World Part 2 ❤️ I Came With Shaved ❤️ Screaming Nipple Acme ❤️ Squirting Water Cannon With Big Chestnut Electric Massager ❤️ Agony Irama ❤️

  • amateur uncensoredfc2
    • 2022-06-29
    47 min

    FC2PPV 2939596 * During Life [Borrowing ○ Repayment Unfinished Disclosure ○ Punishment] Host Crazy Bu 〇 Is Fully Exposed And Punishment.

  • amateur uncensoredfc2
    • 2022-06-29
    39 min

    FC2PPV 2999013 Limited Number! !! [Uncensored] A Pretty Idol Girl Who Belongs To The Tennis Club Who Has Transferred To School … Called After School Unprocessed Unprocessed Hairy Genitals And Vaginal Cum Shot Without Rubber! !!

  • amateur uncensoredfc2
    • 2022-06-29
    48 min

    FC2PPV 2999061 A Very Valuable Rare Project. A Boxed Girl In The Rebellion Period. The Result That Appeared To Parents And Society Was A Large Number Of Vaginal Cum Shots.

  • amateur uncensoredfc2
    • 2022-06-29
    54 min

    FC2PPV 3002358 [4980 → Limited Number 1980] First Appearance, Limited Number! [Uncensored] Celebrity Wife ② Who Lives In Minato-Ku, Tokyo. She Has 400 Debt + 200 Refinancing. She Repays Her Body Without Telling Anyone. Namanakadashi On A Bewitching S

  • amateur uncensoredfc2
    • 2022-06-29
    34 min

    FC2PPV 2998278 Roppongi Men’s Esthetics / Oil Handjob Hidden Shooting / Squirting Course [Riko Kurusu (23 Years Old) 17th] [cen]

  • amateur uncensoredfc2
    • 2022-06-28
    67 min

    FC2PPV 2998164 [Looking For A Room] I Had Sex While Looking For A Rental Property. Lust During A Preview With A Real Estate Agent Alone, Gonzo Video Leaked In A Large Vacant Property Anal * Hikuhiku [Raw Saddle Creampie] [cen]

  • amateur uncensoredfc2
    • 2022-06-28
    49 min

    FC2PPV 2939514 [Personal Shooting] Tomohame! I Took A Gonzo Like A Friend ☆ Honami 24 Years Old ☆

  • amateur uncensoredfc2
    • 2022-06-28
    42 min

    FC2PPV 2998675 [ASMR ★ Monashi] Actually, It Seems To Be A Famous Tiktoker !？ It’s Quite Tsundere-Chan, But Tsundere-Chan Becomes More And More Erotic When The Etch Starts! Last Year’s Suzu-San (20) Challenged Otopaco For The First Time!

  • amateur uncensoredfc2
    • 2022-06-28
    88 min

    FC2PPV 2997370 [No.54] Tokyo 〇〇Kai Medical College Hospital Nurse A-Chan (Shooting Without Telling Girls.) * Review Benefits Available

  • amateur uncensoredfc2
    • 2022-06-28
    79 min

    FC2PPV 2998676 [Special Price Until 7/7] [3 Shots Including 2 Consecutive Vaginal Cum Shot] Time Leap To Female 〇 Students. A Too Beautiful Face And A Naked Receptionist. She Had Revenge Sex When She Was Active With Glasses. [cen]

  • amateur uncensoredfc2
    • 2022-06-28
    44 min

    FC2PPV 2985082 * Limited Time * [J System Date] Too Little Devil De S Beautiful Girl ☆ Night Park Pants Shooting ☆ Nipples And Dick Were Hit With An Angel’s Smile → 2 Vaginal Cum Shot [cen]

  • amateur uncensoredfc2
    • 2022-06-28
    75 min

    FC2PPV 2997916 [Personal Shooting] ★ Genuine God Times ★ Forbidden Do-Up Video Of Active Race Queen Lifted! !! After All The Real Thing Is Different / Rei (24 Years Old)

  • amateur uncensoredfc2
    • 2022-06-28
    31 min

    FC2PPV 2998613 [Individual] Crush The Wife Who Called To The House. Feeling Firm While Being Stunned, Pouring Other People’s Juice

  • amateur uncensoredfc2
    • 2022-06-28
    62 min

    FC2PPV 2998241 ★ Limited To One Week ★ [Ahegao W ✌ ♥] Genuine Sober Glasses Otaku Daughter Capture ♥ A Super Sensitive Body That Is Still Developing And Demon Acme! A ● By Ingesting A Call ((Raw Cock Begging ♡)) Angry Vaginal Cum Shot Copulation ☝ (P

  • amateur uncensoredfc2
    • 2022-06-28
    41 min

    FC2PPV 2997894 Former Gymnastics Uncovered The True Nature Of The Older Sister ☆ Oman ● Forced Strangulation Big Pant Voice Knocked Out 2 Consecutive Shots [cen]

  • amateur uncensoredfc2
    • 2022-06-27
    24 min

    FC2PPV 2994335 Ebisu Mansion Type Private Room Menes Hidden Camera-Smell Sniffing Option Innocent School Beautiful Girl, Shizuku Tsumugi (22 Years Old) [cen]

  • amateur uncensoredfc2
    • 2022-06-27
    30 min

    FC2PPV 2995255 [Personal Shooting] English Married Teacher At A Public School, A Back Face Completely Different From A Serious Teacher

  • amateur uncensoredfc2
    • 2022-06-27
    45 min

    FC2PPV 2993310 [Fan Thanksgiving Day! ] Book ◯ Baby Face Non-Chan Nurse Similar To Nozomi, J ◯ Uniform, Bunny Girl Anything Suits You! Rich Cosplay Etch! Luxury 3-Piece Set

  • amateur uncensoredfc2
    • 2022-06-26
    124 min

    FC2PPV 2987179 ★ Frozen Resurrection ★ Resale ★ I Don’t Know When It Will Disappear! !! ★ G-Cup Beauty Big Breasts Dismissal Boyne Ho ● Shishi Appeared! !! Clearly Speaking, Beautiful Big Breasts, Garden ● Gentle Tamotsu Who Comes Into Contact W

  • amateur uncensoredfc2
    • 2022-06-26
    74 min

    FC2PPV 2993004 Assault Again At The House Of A Beautiful Man Who Lives In A Mansion ♥♥ A Thick And Hard Men’s Cock Is Presented To Her Crotch That Aches With Her Telework ♥♥

  • amateur uncensoredfc2
    • 2022-06-26
    175 min

    FC2PPV 2993195 Former Idol Re-Advent! !! !! Take A Real Idol To Akihabara, And … A Lot Of Crazy … A Genuine Former Entertainer Again! !! !! , From That Super Famous Major Debut Idol Group, The Original 24 Individual Shootings Of The Former

  • amateur uncensoredfc2
    • 2022-06-26
    44 min

    FC2PPV 2987160 Limited To 7/3 [Face Exposure, Uncensored] Kita! !! Teens With Cute Smiles, Puni Skin, And Big Breasts! Plenty Of Raw Vaginal Cum Shot! !! It Was

  • amateur uncensoredfc2
    • 2022-06-26
    35 min

    FC2PPV 2989429 <Bonus Ali> This Is A Real Amateur 3p Ww‼ ️ When I Was Making A Blowjob, I Pretended To Be A Coincidence And Called A Friend To My House And Took It To 3p With Glue Www [cen]

  • amateur uncensoredfc2
    • 2022-06-25
    54 min

    FC2PPV 2985091 The Daughter I Brought Back With Gachinanpa Was Acme But Horny [Appearance] A Miracle That Makes Me Crazy With Sexual Desire For Free! I Like Blowjob Better Than 3 Times Of Rice. A Metamorphosis Woman Who Is Very Satisfied With A Big C

  • amateur uncensoredfc2
    • 2022-06-25
    25 min

    FC2PPV 2986127 Roppongi Men’s Esthetics / Oil Handjob Hidden Shooting / Manguri Return Course [Eina Nagahama (23 Years Old) 19th Time] [cen]

  • amateur uncensoredfc2
    • 2022-06-25
    14 min

    FC2PPV 2985867 <I Haven’t Heard That It Can Be Inserted ❗️> I Forced It Because I Wanted To Do It If I Brought It To An Unpopular Place While Driving And Gave It A Blowjob [cen]

  • amateur uncensoredfc2
    • 2022-06-25
    43 min

    FC2PPV 2983362 [Video 31 Amateur Shooting]

  • amateur uncensoredfc2
    • 2022-06-24
    40 min

    FC2PPV 2985180 [Personal Shooting / Creampie] Snack Work Seeking Only Pleasure 37-Year-Old Mature Wife The Relentless Caress Of A Mature Wife Makes Another Stick Gingin And Prepares For Launch

  • amateur uncensoredfc2
    • 2022-06-23
    62 min

    FC2PPV 2982174 * Half Price Until 6/27! [Leakage] An Exhibitionist Married Woman Who Is Frustrated And Masturbates In The Park Toilet At Night, Consults That She Is Scared Because She Seems To Have An Affair. [cen]

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored