grimosa




FC2MILKSSNICAWDNATRHUNTBHMNIPXAPODCJODDASDVENXPREDPPPDMEYDDTTSHKDDASDMVSDNACXNACR

2020-02-01
120 min

[SSNI-697]A Fallen Honor S*****t - She Gets Subjected To Rough Sex Until She Likes It - Riko Shiraha

  • riko shirahaba censoredschoolgirlbeautiful girlSSNIs1 no 1 stylekitorune kawaguchiSSNI-697SSNI697ssni00697
    • 2020-02-01
    120 min

    [SSNI-689]While My Girlfriend Was Away For A Month, I Could No Longer Endure Celibacy, And Decided To Go For My Girlfriend's Best Friend Instead, And For 14 Whole Days... Moe Amatsuka

  • angel moe censoredbeautiful girlsingle workSSNIs 1 number one stylecomet akais1 no 1 styleSSNI-689SSNI689ssni00689
    • 2020-02-01
    153 min

    [SSNI-702]Amateur No. 1 STYLE Rena Kodama Porn Debut

  • kodama rena censoredbeautiful girlsingle workSSNIs 1 number one styleusapyons1 no 1 styleSSNI-702SSNI702ssni00702
    • 2020-02-01
    153 min

    [SSNI-700]See Through With No Bra, J Cups Fall Out, Temptation Of Clothed Hot Tits, Lala Anzai

  • anzai rara censoredbig titssingle workSSNIs 1 number one stylekyouseis1 no 1 styleSSNI-700SSNI700ssni00700
    • 2020-01-16
    153 min

    [SSNI-684]Her Slender Body Spasms And She Screams When She Cums - She Gets Piston-Fucked Like You Wouldn't Believe - Shihori Kotoi

  • shiori kotoi censoredsquirtingsingle workSSNIs1 no 1 styleusa pyonSSNI-684SSNI684ssni00684
    • 2020-01-16
    119 min

    [SSNI-678]Non-Stop! 10 Cumshots! Dribbling Spit And Drool! Deep Kissing Orgasms That Would Make Your Brain Melt! - Inviting A Slut To Have Sex - Nene Yoshitaka

  • nine yoshitaka censoredblowjobslutSSNIs1 no 1 stylekyoseiSSNI-678SSNI678ssni00678
    • 2020-01-16
    161 min

    [SSNI-682]She's Totally Dedicated To All 12 Male Team Members A Titty Fuck Specializing J-Cup Titty Cum Bucket Girl Will Manage All Of The Team Member's Sexual Needs Jun Kakei

  • jun jun censoredbig titsblowjobSSNIs 1 number one stylemaeda bungos1 no 1 styleSSNI-682SSNI682ssni00682
    • 2020-01-16
    120 min

    [SSNI-676]While My Best Friend Was Away On A Business Trip, I Spent 72 Hours Fucking His Girlfriend From Morning Til Night, And Here's The Video Record To Prove It Aika Yumeno

  • yumeno aika censoredbig titssingle workSSNIs1 no 1 stylejo asagiriSSNI-676SSNI676ssni00676
    • 2020-01-16
    118 min

    [SSNI-677]Arina Is Cute And Stuck Up, And I Was Jealous Of Her, So I Asked My Male Friends To Take Revenge In My Place And Fuck The Shit Out Of Her, Over And Over Again Arina Hashimoto

  • there is hashimoto censoredbeautiful girldeepthroatSSNIs1 no 1 stylebungo maedaSSNI-677SSNI677ssni00677
    • 2020-01-16
    160 min

    [SSNI-680]This Married Woman Just Wanted To Maintain Her Style On Her G-Spot Makes This Married Woman Lose Her Mind In Cum Crazy Ecstasy - A Spasmic Back-Breaking Orgasmic Oil Massage Parlor - Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSNIs1 no 1 stylehirokoji osakiSSNI-680SSNI680ssni00680
    • 2020-01-16
    118 min

    [SSNI-675]Class Reunion NTR I Never Would Have Imagined That My Wife Could Get Fucked Again By Her Piece-Of-Shit Ex-Boyfriend Who Used To Toy With Her Like A Piece Of Meat... Tsukasa Aoi

  • tsukasa aoi censoredsingle workdramaSSNIs1 no 1 stylekitorune kawaguchiSSNI-675SSNI675ssni00675
    • 2020-01-16
    130 min

    [SSNI-686]Mixed Bodily Fluids, Deep Sex - Completely Uncut Special - Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingbeautiful girlSSNIs1 no 1 stylemon cSSNI-686SSNI686ssni00686
    • 2020-01-16
    120 min

    [SSNI-674]A Female Boss With Big Tits And Her Cherry Boy Colleague Stay In The Same Room On A Business Trip - She Seduces Him For Fun And Makes Him Cum 10 Times - Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-674SSNI674ssni00674
    • 2019-12-28
    119 min

    [SSNI-666]G*******g Fucking The New Female Teacher I Got Fucked By My S*****ts, While My Boyfriend Watched Nodoka Sakuraba

  • sakuraha nodoka censoredbig titsbeautiful girlSSNIs1 no 1 styleamazing meatSSNI-666SSNI666ssni00666
    • 2019-12-28
    120 min

    [SSNI-659]I Continued To Be Cuckold Fucked Underneath The Futon, Over And Over And Over Again... While Her Fiancee Was Right Nearby, Her Orgasmic Boss Relentlessly Gave Her A Total Coverage Fuck And She Knew It Was Wrong, But She Came Anyway During T

  • angel moe censoredsingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-659SSNI659ssni00659
    • 2019-12-28
    119 min

    [SSNI-663]Cum Facial Jizz That Flows Out From Her Body All That Pussy Juice Came Out With A Meringue-Like Consistency And Kept On Dripping Out Because Of All This Amazing Piston-Pumping Action Miru Sakamichi

  • see the slope censoredsquirtingbeautiful girlSSNIs1 no 1 stylezampaSSNI-663SSNI663ssni00663
    • 2019-12-28
    179 min

    [SSNI-673]4 Beautiful Girls All To Myself! Super Harem 5 Person Fuck Special

  • miharu hanasaki yura kanno censoredsquirtingbeautiful girlSSNIs1 no 1 styleusa pyonSSNI-673SSNI673ssni00673
    • 2019-12-28
    118 min

    [SSNI-662](*Abnormally Massive Orgasms) The Greatest Eros Company Awakening! Furious Non-Stop Serious Sex Until All Lust Has Been Depleted Miharu Usa

  • miharu hanasaki censoredbig titssquirtingSSNIs1 no 1 stylezaku araiSSNI-662SSNI662ssni00662
    • 2019-12-28
    157 min

    [SSNI-667]Wearing A Maxi Dress With Nothing Underneath... Mao Mashiro

  • pure white censoredbig titssingle workSSNIs1 no 1 stylekyoseiSSNI-667SSNI667ssni00667
    • 2019-12-28
    151 min

    [SSNI-669]131 Furious Orgasms! 5200 Spasms! 2300cc Of Orgasmic Squirts! A Minimum Body With A Small Waist An Eros Company Awakening Massive Spasmic Special Rin Kira

  • kira rin censoredsquirtingbeautiful girlSSNIs1 no 1 styleusa pyonSSNI-669SSNI669ssni00669
    • 2019-12-28
    118 min

    [SSNI-664]She's Mounting This Greasy, Oily Middle-Aged Dirty Old Man And Getting Sweaty And Juicy And Shaking Her Big Ass In Voluptuous Big Butt Human Battle Piston Pumping Sex Shion Yumi

  • evening beauty censoredbig titssquirtingSSNIs1 no 1 stylezaku araiSSNI-664SSNI664ssni00664
    • 2019-12-28
    149 min

    [SSNI-668]A Sensual Slender Beautiful Girl In A Thrilling And Throbbing Sexual Adventure: A Full Course Of Whore All 5 Clubs Are Pouring Their Hearts Out To Thoroughly Service You! Riko Shiraha

  • riko shirahaba censoredsingle workSSNIs1 no 1 stylemon cSSNI-668SSNI668ssni00668
    • 2019-12-28
    163 min

    [SSNI-665]A Video Record Of My Girlfriend, Getting Cuckold Fucked For 10 Days, While Appearing In A Live Erotic Chat Hotaru Nogi

  • nogi firefly censoredbig titsbeautiful girlSSNIs1 no 1 styletake dSSNI-665SSNI665ssni00665
    • 2019-12-28
    120 min

    [SSNI-660]While Her Husband Was Away For 2 Days, She Obeyed Her Basic Instinct And Lost Herself In Adultery Sex Durin An Unfaithful Weekend Saki Okuda

  • saki okuda censoredbig titssingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-660SSNI660ssni00660
    • 2019-12-28
    138 min

    [SSNI-670]Mixed Body Fluids, Deep Sex Complete And Uncut Special Sora Amakawa

  • tenkawa sora censoredblowjobsingle workSSNIs1 no 1 stylemon cSSNI-670SSNI670ssni00670
    • 2019-12-14
    119 min

    [SSNI-652]Beautiful Bouncy Tits - A Lucky Encounter With A Beautiful Woman With Hot Tits SP - Jun Aoi

  • jun jun censoredbig titsbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-652SSNI652ssni00652
    • 2019-12-14
    120 min

    [SSNI-651]While My Girlfriend Went On A Vacation With Her Family For 3 Days, I Spent The Entire Time Fucking Her My C***dhood Friend, From Morning Until Night, And Making Summertime Memories, And I Here Is The Video Record To Prove It Mako Iga

  • iga mako censoredbeautiful girlsingle workSSNIs1 no 1 stylerokusaburo mishimaSSNI-651SSNI651ssni00651
    • 2019-12-14
    149 min

    [SSNI-649]Doing It With A TSUNDERE Girl Quietly Playing With Her Nipples And Getting A Handjob In The Back Of a Professional Salon - Yura Osamu

  • yura kanno censoredhandjobsingle workSSNIs1 no 1 styleusa pyonSSNI-649SSNI649ssni00649
    • 2019-12-14
    150 min

    [SSNI-656]181 Furious Orgasms! 6012 Spasms! 8706cc Of Squirts! She's Got An Ultra Sensual Slim Body Eros Company Awakenings Her First Massive, Orgasmic Special Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingbeautiful girlSSNIs1 no 1 stylemon cSSNI-656SSNI656ssni00656
    • 2019-12-14
    118 min

    [SSNI-645]I Was Always In Love With The Boss' Wife, Tsukasa-san, So I Secretly Lost My Mind Fucking Her Hard And Tight Underneath The Futon Tsukasa Aoi

  • tsukasa aoi censoredsingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-645SSNI645ssni00645
    • 2019-12-14
    120 min

    [SSNI-654]Because He Was Her Father-In-Law, She Could Not Refuse His Demands, And While Her Husband Was Nearby, He Fucked Her Every Night And Made Her Cum... Shihori Kotoi

  • shiori kotoi censoredsquirtingsingle workSSNIs1 no 1 stylek westSSNI-654SSNI654ssni00654
    • 2019-12-14
    236 min

    [SSNI-653]Welcome To The Highest-Grade Celebrity Sex Club Apartment House The Hard And Tight Sensual Technique Of Marin Hinata A 240-Minute Full Course

  • marin hinata censoredsquirtingsingle workSSNIs1 no 1 stylezaku araiSSNI-653SSNI653ssni00653
    • 2019-12-14
    173 min

    [SSNI-644][*Abnormal Orgasmic Ecstasy] The Most Massive Eros Company Awakening! Furious Non-Stop Serious Sex Until She Uses Up All Of Her Lust Yua Mikami

  • yua mikami censoredbig titssquirtingSSNIs1 no 1 stylemichiru arashiyamaSSNI-644SSNI644ssni00644
    • 2019-11-30
    156 min

    [SSNI-638]Sweaty Sex With H-Cup Tits In Tight-Fitting Sportswear - Mao Mashiro

  • pure white censoredbig titssingle workSSNIs1 no 1 styledragon nishikawaSSNI-638SSNI638ssni00638
    • 2019-11-30
    152 min

    [SSNI-639]Deep And Rich Sloppy Kissing Sex With A Beautiful Girl Getting Sweaty And Wet And Drooling And Slobbering All Over The Place Riko Shiraha

  • riko shirahaba censoredsquirtingblowjobSSNIs1 no 1 styleusa pyonSSNI-639SSNI639ssni00639
    • 2019-11-30
    157 min

    [SSNI-637]Her Pussy Twitches When She Climaxes, Getting The Fucking Of Her Life, Hard And Relentless - Nodoka Sakuraba

  • sakuraha nodoka censoredbig titssquirtingSSNIs1 no 1 styledragon nishikawaSSNI-637SSNI637ssni00637
    • 2019-11-30
    149 min

    [SSNI-642]Exquisite Pleasure! Sorano Amakawa Is An Adult Video Idol And She's Cumming For The First Time! Super Orgasmic First Experiences A 3-Fuck Special

  • tenkawa sora censoredbeautiful girlsingle workSSNIs1 no 1 stylemon cSSNI-642SSNI642ssni00642
    • 2019-11-30
    131 min

    [SSNI-640]Mixed Body Fluids, Deep Sex Complete And Uncut Special Rin Kira

  • kira rin censoredsquirtingbeautiful girlSSNIs1 no 1 stylelamb chopSSNI-640SSNI640ssni00640
    • 2019-11-14
    118 min

    [SSNI-622]This Man Is Tied Up And Unable To Move As This Healthy Slut With A Beautiful Body Keeps On Assaulting Him With A Smile As She Fully Controls His Ejaculations Nene Yoshitaka

  • nine yoshitaka censoredslutsingle workSSNIs one number one stylecrests1 no 1 styleSSNI-622SSNI622ssni00622
    • 2019-11-14
    118 min

    [SSNI-619]I Was Having Life-Destroying Orgasmic Sex With The Married Woman Next Door Tsukasa Aoi

  • tsukasa aoi censoredsingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-619SSNI619ssni00619
    • 2019-11-14
    152 min

    [SSNI-625]Welcome To The Super High Class J-Cup Sex Club Condo Enjoy A 150-Minute Full Course Of Jun Kakei's Hard And Tight Sensual Techniques

  • jun jun censoredbig titssingle workSSNIs one number one stylezampas1 no 1 styleSSNI-625SSNI625ssni00625
    • 2019-11-14
    120 min

    [SSNI-627]27 Years Old - Falling Into Disgrace Before She Reaches 30 - She Climaxes So Hard You Can See Her Ribs! She Orgasms With A Huge Dick Rubbing Against Her G-Spot! - Shihori Kotoi

  • shiori kotoi censoreddeepthroatsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-627SSNI627ssni00627
    • 2019-11-14
    119 min

    [SSNI-624]3 Years Ago My Lady Boss Retired To Get Married, But Now That She's Back, I Spent 3 Days At A Hotel During My Business Trip Fucking Her Brains Out, And Here's The Video Record To Prove It Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSNIs one number one stylemeat respects1 no 1 styleSSNI-624SSNI624ssni00624
    • 2019-11-14
    210 min

    [SSNI-618]Total Domain A Voluptuous Thighs In Uniform Peek-A-Boo Show A Bare-Legged Idol In The Ultimate Temptation A Little Devil Beautiful Girl In Knee-High Socks Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-618SSNI618ssni00618
    • 2019-11-14
    119 min

    [SSNI-620]A Tiny Girlfriend With Light Skin And Big Tits Is Getting Stroked By Her Big Dick Friend In A Horse-Hung Straddling Fuck Fest For Cuckold Pleasure Palace Orgasmic Ecstasy Aika Yumeno

  • yumeno aika censoredbig titssingle workSSNIs one number one styleasagiris1 no 1 styleSSNI-620SSNI620ssni00620
    • 2019-11-14
    122 min

    [SSNI-629]A Sensual Slim Body Hiyori Yoshioka Hear Her Scream! Watch Her Cum! See Her Seriously Cum! A 3 First Experiences Special

  • hiyori yoshioka censoredsquirtingblowjobSSNIs1 no 1 stylezaku araiSSNI-629SSNI629ssni00629
    • 2019-11-14
    120 min

    [SSNI-621]Her Legs Measure 88cm From Her Crotch To The Floor A Barely Legal Babe With Beautiful Legs The Temptation Of A High-Cut Uniform Arina Hashimoto

  • there is hashimoto censoredsquirtinguniformSSNIs one number one stylekyouseis1 no 1 styleSSNI-621SSNI621ssni00621
    • 2019-11-14
    120 min

    [SSNI-623]While My Girlfriend Was Away, I Spent 3 Days Fucking The Shit Out Of My Girlfriend's Best Friend, An Adult Video Actress Yura Kano

  • yura kanno censoredbeautiful girlsingle workSSNIs one number one styleasagiris1 no 1 styleSSNI-623SSNI623ssni00623
    • 2019-11-14
    195 min

    [SSNI-626]Mixed Body Fluids, Deep Sex Complete And Uncut Special Marin Hinata

  • marin hinata censoredbig titssingle workSSNIs1 no 1 stylemon cSSNI-626SSNI626ssni00626
    • 2019-11-14
    136 min

    [SSNI-628]She Cums 96 Times! She Spasms 3,000 Times! She Squirts 2,100cc Of Pussy Juice! - A Slim Girl With Massive Tits Experiences Overwhelming Spasming Sex - Amin Niina

  • new name amin censoredbig titssquirtingSSNIs1 no 1 stylemon cSSNI-628SSNI628ssni00628
    • 2019-11-02
    120 min

    [SSNI-611]Sensual Stimulation With Cum Facial Aphrodisiac Lotion! She's Awakening Her Ultra Sensual Full Body Erogenous Zone! A New Encounter With Slick And Slippery Orgasmic Sex Rika Aimi

  • rumi tadami censoredbig titssingle workSSNIs one number one stylesugawaras1 no 1 styleSSNI-611SSNI611ssni00611
    • 2019-11-02
    150 min

    [SSNI-613]Mixed Body Fluids, Deep Sex A Totally Uncut Special Mao Mashiro

  • pure white censoredbig titssingle workSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-613SSNI613ssni00613
    • 2019-11-02
    150 min

    [SSNI-617]New Face NO.1 STYLE Sora Amakawa's Porn Debut

  • tenkawa sora censoredsquirtingblowjobSSNIs1 no 1 stylemon cSSNI-617SSNI617ssni00617
    • 2019-11-02
    150 min

    [SSNI-612]A Beautiful Young Girl And A Middle-Aged Man Engage In Extreme, Vulgar Tongue-Kissing And Sex - Nodoka Sakuraba

  • sakuraha nodoka censoredbig titsblowjobSSNIs one number one styleusapyons1 no 1 styleSSNI-612SSNI612ssni00612
    • 2019-11-02
    119 min

    [SSNI-610]The Investigator Got Her Pure Sailor Uniform Defiled And Soiled The Virgin Deflowering And Penetrating Fuck Fest! Hotaru Nogi

  • nogi firefly censoredblowjobbeautiful girlSSNIs1 no 1 stylebungo maedaSSNI-610SSNI610ssni00610
    • 2019-11-02
    118 min

    [SSNI-606]There Was Nothing To Do In The Country This Summer, So I Let The Big Tits Wife From Next Door Lure Me To Temptation And Had Sweaty, Slow Sex Every Single Day Sai Okuda

  • saki okuda censoredbig titsslutSSNIs1 no 1 stylekitorune kawaguchiSSNI-606SSNI606ssni00606



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored