holding




FC2VENXNNPJDTTHUNTBHDKAFSDSSHMNMARAMVSDATIDMEYDMIAABLKCJODKSBJNGODMIDVSHKDKBINACR

2021-01-01
165 min

[MEAT-027]Big Booty Temptation Men's Massage Parlor - Masseuse With Hard-Humping Piston Cowgirl SK**ls Will Bust Your Nut Yuri Honma

  • really censoredslutMEATbig the meat path delusional familyMEAT-027MEAT027meat00027
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-29
    109 min

    FC2PPV 1664477 3Q Legend ♥ ️ Urgent Limited Release ♥ ️ Tsundere Beauty Receptionist With Beautiful Breasts, Nice Bottoms, Beautiful Legs Revives A Miracle ♥ ️ First Experience SM Insistence ○ Losing Pride And Shame In Play Incontinence Acme & Va

  • amateur uncensoredfc2
    • 2021-01-30
    96 min

    FC2PPV 1664950 [First appearance 1st place God Fcup beauty witch other married woman! De M Training Preface NTR Extreme w] The affair of a beautiful wife that her husband does not know develops to de M training! I can not do it! Continuous demon squi

  • amateur uncensoredfc2
    • 2021-02-02
    89 min

    261ARA-474 [Super beautiful body] 23 years old [Surprising fact] Miyabi-chan is here! The reason for her application, who is usually a cosmetologist, is “I have a strong desire to be seen …” Exposure transmitted from exciting clothes!

  • amateur censoredbig titssquirtingaraara-474ara474261ara-474
    • 2021-02-10
    13 min

    S-Cute 805_urara_05 Cowgirl H with a cute shy smile after getting caught / Urara

  • urara censoredamateururaraurara-05urara05805-urara-05
    • 2021-02-11
    136 min

    [NEO-753]Armpit Sweat And Semen - Tsukasa Nagano

  • tsukasa nagano censoredsingle workNEOradixshio sakurabaneo paradoxNEO-753NEO753433neo00753
    • 2021-02-12
    67 min

    [ZOZO-038]Miss Miyuki Arisaka

  • censoredcreampieZOZOsadie willenauZOZO-038ZOZO0381zozo00038
    • 2021-02-15
    80 min

    259LUXU-1384 Luxury TV 1366 An active fashion magazine model with a cute face, beautiful style, and impeccable looks. Is it because of her willingness to regain her self-confidence, or because of her rushing pleasures that she forgot to open her stri

  • amateur censoredamateurluxuluxu-1384luxu1384259luxu-1384
    • 2021-02-25
    179 min

    [HAWA-239]Young Wife Loves Old Men And Will Suck Anyone's Dick When She's Horny!!

  • censoredamateurblowjobHAWAcosmos eizohawai nagasecosmospictures soft on demandHAWA-239HAWA2391hawa00239
    • 2021-02-26
    79 min

    230OREC-706 Mirei

  • amateur censoredcreampiebig titsorecorec-706orec706230orec-706
    • 2021-02-27
    139 min

    [MCSR-426]A Married Woman's Creampie Adultery Vacation - Riho Fujimori

  • riho fujimori censoredcreampiebig titsMCSRbig morkalyumejimascottMCSR-426MCSR42657mcsr00426
    • 2021-02-27
    120 min

    [JUFE-263]Beautiful Secretary With A Nice Plump Body And Colossal Tits Flaunts Her Sexual Desires And Addiction To Cock! Rui Miura

  • rui miura censoredcreampiebig titsJUFEfitchJUFE-263JUFE263jufe00263
    • 2021-02-28
    34 min

    330PER-367 Yukino

  • amateur censoredamateurperper-367per367330per-367
    • 2021-03-07
    128 min

    [PKPD-134]完全プライベート映像 超絶神スタイルおねえさん 緑川みやびと初めての二人きりお泊まり 緑川みやび

  • midorikawa miyabi censoredbig titssingle workPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-134PKPD134pkpd00134
    • 2021-03-17
    130 min

    [GVH-205]Naughty Nurses - Rei Kuruki

  • satoshi kuruki censoredcreampiegrandfatherGVHglory questmishima rokusaburoGVH-205GVH20513gvh00205
    • 2021-03-25
    51 min

    330PER-376 Tsumugi

  • amateur censoredcreampieamateurperper-376per376330per-376
    • 2021-03-27
    95 min

    [VEMA-161]My Beautiful Teacher Is The Homeroom Teacher And My Lover ~ Forbidden Passionate Raw Sex All Day With My Older Girlfriend ~ Yukino Nagasawa

  • yukino nagasawa censoredcreampiemarried womanVEMAvenustamatsuka bingogoddess venusVEMA-161VEMA161vema00161
    • 2021-03-30
    74 min

    FC2PPV 1747993 First shot ♥ ️ Pichi popping white skin ♪ The erotic appearance of a serious woman is moe [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-03
    59 min

    HEYZO 2493 That Whispered Married Busty Woman Is Cum Swallow Lover!？ – Rino Sakuragi

  • rino sakuragi uncensoredcreampieblowjobheyzo
    • 2021-04-09
    115 min

    [IPX-641]I Hope My Husband Never Finds Out - Today I'm Being Ravished By My Father-In-Law Again. He Keeps Making Me Cum... Karen Kaede

  • karen kaede censoreddeepthroatsingle workIPXidea pocketshiro shotendishIPX-641IPX641ipx00641
    • 2021-04-09
    213 min

    [BAZX-284]Thick Sex With A Widow In Mourning Dress vol. 003

  • censoredcreampieBAZXbazookatodoBAZX-284BAZX284bazx00284
    • 2021-04-12
    102 min

    [DORI-016]Fuck Films No. 16 - Beautiful Tits With Puffy Pink Nipples - Carefree S********l Says No To Gross Older Guys, But She Happily Takes Their Cocks Anyhow!

  • censoredbig titsuniformDORIfirst starpaco shootingDORI-016DORI016h-491dori00016
    • 2021-04-14
    159 min

    [ROYD-051]"Come Live With Me Again!" Our Parents Split When We Were K*ds, But Now My Stepsister Wants To Move In With Me Again, Eight Years Later! She's Grown Into An Adorable Young Woman Who Wants My Creampie Every Single Day Mao Watanab

  • mao watanabe censoredcreampieschoolgirlROYDroyalkoichi davidsonhhh groupROYD-051ROYD051royd00051
    • 2021-04-16
    67 min

    [tkwa-167]ひすい

  • amateur censoredcreampieschoolgirltkwatkwa-167tkwa167tkwa-167
    • 2021-04-24
    96 min

    [VENX-031]When Her Stepson Creampie Fucks Her, She'll Clean Him Up With A Blowjob, And Then Get Him Rock Hard Again So He Can Pump Her Pussy And Empty His Balls Out In An Endless Loop Of Shameful Fucking Sayuri Mitsumoto

  • sayuri mitsumoto censoredcreampiebig titsVENXvenussarufakecest winntersVENX-031VENX031venx00031
    • 2021-04-30
    64 min

    SIRO-4510 [First shot] [Fresh E cup x pre-buttocks] [Sorrowful anime voice] A stoic beautiful girl who goes to the gym while attending a dance vocational school and is eager to polish herself. She plays a cute cry when she is tampered with sensitive

  • amateur censoredamateursirosiro-4510siro4510siro-4510
    • 2021-05-06
    98 min

    [HONE-260]Soft Pressure And Squishy Squeezing! Groping My Step Mom's Titties Mako Oda

  • oda mako censoredcreampiebig titsHONEcenter villagesouthern earthhanazono center villageHONE-260HONE260h-086hone00260
    • 2021-05-13
    79 min

    KDS-004 [Delivery only] Kyun de Shun VOL.4 Mao 21 years old I want to have sex like a beast! Mutsuri JD with a desire to be messed up! !! Brain juice busher for the first Irama! !! !!

  • amateur censoredamateurkdskds-004kds004kds-004
    • 2021-05-22
    243 min

    [GIGL-647]It's True That Out In The Country, There's Nothing To Do But Fuck... In This Quiet, Isolated Village, We Met This Wonderful Old Lady With A Gentle Smile And An Organic Natural Airhead Body Trained In The Great Outdoors Who Showed Us

  • yoshizawa nasakura shimazaki kasumi censoredmature womanGIGLgigolo gigolojun nagasawagigoloGIGL-647GIGL647gigl00647
    • 2021-05-27
    50 min

    H0930 ki210527 Akemi Hyodo 30years old

  • amateur uncensoredh0930
    • 2021-06-15
    49 min

    H0930 ki210615 Fumiko Ashizaki 50years old

  • amateur uncensoredh0930
    • 2021-06-19
    100 min

    390JAC-094 [172cm / H Cup God Body x 4 Creampies] Dawn! !! !! Dawn! !! !! Dawn! !! !! In this world, black, white, mamba, and princess are all lonely gals. I will fill the gap in the crotch of such a gal. No, I don’t get any money. If the custom

  • amateur censoredcreampiebig titsjacjac-094jac094390jac-094
    • 2021-06-21
    68 min

    SIRO-4519 AV application on the net → AV experience shooting 1568 [First shot] [THE sex symbol] [Big breasts x big butt x big iki] Arasa beauty who is about to get married makes memories secretly to her boyfriend. Shake the soft milk of the I cup in

  • amateur censoredbig titsamateursirosiro-4519siro4519siro-4519
    • 2021-07-23
    160 min

    [LULU-084]My Emotionally Disturbed Big Tits Lover Loves Me Too Much, So She Moved In Next Door, And She Started Tweaking My Nipples In A Jealous Fit, And Fucked Me Dry, And Ever Since Then, She's Been Making Me Ejaculate, Over And Over Again, Beh

  • arioka miu censoredcreampiebig titsLULUlunaticsvagmanLULU-084LULU084lulu00084
    • 2021-07-26
    36 min

    285ENDX-354 Super Kawa Super Erotic! A Young Character With An Ani Voice! Moe ~

  • amateur censoredcreampiesquirtingendxendx-354endx354285endx-354
    • 2021-08-10
    60 min

    230OREC-839 Mako (29 Years Old) 3rd Year Of Marriage

  • amateur censoredcreampiemarried womanorecorec-839orec839230orec-839
    • 2021-08-26
    73 min

    515BTGL-016 (23)

  • amateur censoredcreampiebig titsbtglbtgl-016btgl016515btgl-016
    • 2021-09-04
    139 min

    [SORA-330]I Want You To Love Every Part Of Me, Down To My Asshole. Yuri-san (34 Years Old) Anal Fuck / A 2-Hole Threesome Fuck Fest / Colossal Tits / A Tiny Body / Asshole Ecstasy / Consecutive Cumming / Amateur / Married Woman

  • hamazaki mao censoredsingle workdramaSORAyama to sorayo sukeSORA-330SORA330sora00330
    • 2021-09-10
    131 min

    [NGOD-154]In Order To Help Out Her Family"s Finances, This Housewife Started Working Non-Fulltime Hours At This Company, And During Her Probationary Period, Her Horny Boss Had Eyes On Her And Turned Her Into His Own Personal Cum Bucket ... 2 Reik

  • kobayakawa reiko censoredbig titsmature womanNGODjet eizomanji groupNGOD-154NGOD154ngod00154
    • 2021-09-12
    15 min

    10musume 091221_01 Secret Pussy Collection: Yui Asakawa 2

  • amateur uncensored10musume
    • 2021-09-23
    83 min

    413INST-166 [Active Bus Guide] ● Outflow Individual Shooting ● Certain ○○ Sightseeing Beauty Guide Gonzo Take Off Appointment Individual Shooting Slut Who Eats A Man Who Loves Cock

  • amateur censoredcreampiebig titsinstinst-166inst166413inst-166
    • 2021-10-06
    136 min

    [GVH-295]Meet The S*****t Council Brats Who Group Fucked Their Hot Teacher And The Sexy PTA Chairwoman Honoka Kimura & Yuri Mizukawa

  • honoka kimura yuri mizukawa censoredbig titsGVHglory questhyonGVH-295GVH295gvh00295
    • 2021-10-15
    82 min

    259LUXU-1494 Luxury TV 1470 A Beautiful Medical Student Who Is Unfamiliar With Sex From An Environment That Grew Up In A Serious And Overprotected Family Appears On AV! When She Is Gently Caressed By An Inexperienced Body, She Gradually Becomes Encha

  • amateur censoredbig titsamateurluxuluxu-1494luxu1494259luxu-1494
    • 2021-10-16
    120 min

    [AQSH-077]My Junior Colleague"s Beautiful Wife A Man That Knows Her Escort Past Was Her Husband"s Senior Colleague... Rei Kuruki

  • satoshi kuruki censoredcreampiemature womanAQSHaqua mall heroaqua mallAQSH-077AQSH077aqsh00077
    • 2021-10-23
    244 min

    [SGKX-009]A Gal Chain Reaction Private Video Documentary (Gal-stagram #006) A Special Massive Gathering Of Nookie Gals! A Heaven-Sent Babe Of Spasmic, Orgasmic Erotic Ecstasy! Check Out Her Jiggling And Wiggling G-Cup Colossal Tits! Enjoy Splattering

  • nagi rikax censoredcreampiebig titsSGKXhame chanharii ichigal suta gramSGKX-009SGKX009h-1575sgkx00009
    • 2021-11-17
    115 min

    420HOI-170 Duck (22) Amateur Hoi Hoi Z, Amateur, Lady, Ballet Instructor, Neat Flag, Super Erotic, 22 Years Old, Beautiful Girl, Beautiful Breasts, Neat, Facial Cumshot, Gonzo (Swan)

  • amateur censoredamateurbeautiful girlhoihoi-170hoi170420hoi-170
    • 2021-12-06
    90 min

    [107SDHS-028]すず(24)

  • amateur censoredcreampieamateursdhssdhs-028sdhs028107sdhs-028
    • 2021-12-25
    138 min

    [CEMD-102]I"m Sorry I Peed So Much...34 Mei Satsuki

  • satsuki mei censoredmature womansingle workCEMDceleb no tomoCEMD-102CEMD102cemd00102
    • 2022-01-08
    58 min

    [010822-001]The Story Of Luxury Soapland Lady Vol.96

  • hitomi uncensoredcreampiecaribbeancom
    • 2022-01-14
    52 min

    [ETQR-339][Daydream POV] Total Obedience, Ovulation Day, Slut Maid, And Sex To Have C***dren. Riho Takahashi.

  • riho takahashi censoredcreampieblowjobETQRerotic timeETQR-339ETQR339etqr00339
    • 2022-01-22
    115 min

    [MMUS-061]Beautiful Little Devil Temptation - Mai Hanagari

  • flower hunting censoredschoolgirlslutMMUSmarrionkijin kasaikcpMMUS-061MMUS061mmus00061
    • 2022-02-06
    73 min

    534IND-038 Saba Saba Gal _ Fetish Play Ok Daughter And Continuous Fornication (Terada Here)

  • amateur censoredcreampieamateurindind-038ind038534ind-038
    • 2022-02-17
    149 min

    [AKDL-168]I Won"t Forgive You, Even If You Cum! I Was Made To Cum Repeatedly Through Continuous Blowjobs

  • misaki azusa arimura nozomi censoredbig titsschoolgirlAKDLakinoriaknrAKDL-168AKDL1681akdl00168
    • 2022-03-04
    119 min

    [SSIS-349]112 Wild Orgasms! 4500 Spasms! 1800CC Squirt Juice! Ria Yamate. Eros Awakening. First Great Spasm Special

  • ria yamate censoredsingle workSSISs1 no 1 styleichigoharaSSIS-349SSIS349ssis00349
    • 2022-03-10
    240 min

    [NEO-429]Cum On Ass, 12 Assholes Soaking With Semen And Pussy Juice

  • blue horikita wan censoredanalbukkakeNEOradixneo radixNEO-429NEO429433neo00429



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored