jcup




FC2SHKDFSDSSSTARSVENXGVHNGODBLKHNDPPPDMVSDVENUDASDCHRVMARACAWDSQTEMIDEVEMAAPODHZGD

2020-11-19
170 min

[ROYD-030]My Stepsister Is The Quiet, Reserved Type, But She's Gorgeous When She Takes Off Her Glasses And I've Always Had Feelings For Her. When I Finally Confessed, A Thigh Job Led To Creampie Sex. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiebeautiful girlROYDroyalkawajirihhh groupROYD-030ROYD030royd00030
    • 2020-11-25
    66 min

    374SHOW-032 Asumi (27)

  • amateur censoredbig titsamateurshowshow-032show032374show-032
    • 2020-12-10
    53 min

    FC2PPV 1601468 [Complete appearance → It’s really dangerous if you get caught] Her friend boyfriend! The first 3P❤ G cup busty girl to argue! Cock-loving NTR reappears ❤ Paipan pussy G-spot Goryu Egu is raw ♪ First ever 4 consecutive vaginal cum

  • amateur uncensoredfc2
    • 2020-12-16
    65 min

    SWEET-047 Suzu

  • amateur censoredbig titsschoolgirlsweetsweet-047sweet047sweet-047
    • 2020-12-20
    150 min

    [JUL-414]Thoroughly Licked: Addicted To The Persistently Lecherous Tongue Of Her Husband's Coworker - Inori Fukasawa

  • fukasawa inori censoredbig titsmature womanJULmadonnabieber gonzoJUL-414JUL414jul00414
    • 2021-01-06
    51 min

    FC2PPV 1634672 Limited to 300 [Uncensored] Bakery signboard girl JD’s big butt ejaculation and continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-24
    27 min

    FC2PPV 1657528 Until 27th 2480pt → 1980pt [Personal shooting] Beautiful office lady at the reception desk of the company ・ Because the repayment period has expired, four other sticks will receive interest in the car.

  • amateur uncensoredfc2
    • 2021-01-26
    117 min

    [NUBI-047]I Went To A Masturbation Club And Wasn't Satisfied With Just A Handjob, And This Sexy Girl At First Demurred, But I Could Tell She Was Enjoying It, So I Fucked Her.

  • censoredhandjobNUBIkalimantannubiaNUBI-047NUBI047h-1112nubi00047
    • 2021-02-02
    47 min

    C0930 ki210202 Masae Hamano 44years old

  • amateur uncensoredc0930
    • 2021-02-12
    39 min

    417SRYA-006 I found a rainy day flasher J ●! !! When I witnessed the outdoor masturbation of Gal J ●, I couldn’t stand it and it was convex! Gal J ● Slimy Ma ● Ko uncle Ji ● Po was raw ww

  • amateur censoredcreampieschoolgirlsryasrya-006srya006417srya-006
    • 2021-02-12
    120 min

    [NATR-651]Betrayed By My Lovely Husband - Kaori Hirasei

  • hira kiyoka censoredcreampiesingle workNATRnadeshikoNATR-651NATR651h-067natr00651
    • 2021-02-18
    77 min

    [AKDL-085][Cuckolding At Work] Footage Of Me Talking My Beautiful Married Coworker Into Being Unfaithful And Having Sex With Me - Natsuki Takeuchi

  • natsuki takeuchi censoredmarried womanamateurAKDLaquinoriaquinoriaknrAKDL-085AKDL0851akdl00085
    • 2021-02-25
    65 min

    FC2PPV 1701078 [Complete amateur 101] Azusa 19 years old, complete appearance, vaginal cum shot from the beginning! A masochistic G-cup girl.

  • amateur uncensoredfc2
    • 2021-02-25
    61 min

    1Pondo 022521_001 Browjob and SEX in the Futon: Airi Mikumo

  • amateur uncensored1pondo
    • 2021-02-27
    79 min

    355OPCYN-148 Asuka

  • amateur censoredamateurbeautiful girlopcynopcyn-148opcyn148355opcyn-148
    • 2021-03-11
    48 min

    FC2PPV 1721751 [No] Big breasts poverty graduate student who was in trouble with school expenses 1 Is it okay to have a vaginal cum shot with Sakichi？ ♥ ️ Limited number discount only now ※ Review privilege / Denma strong and bicubic masturbation ♥

  • amateur uncensoredfc2
    • 2021-03-18
    76 min

    1Pondo 031821_001 Hospitality: Cute Girls Who Make Men So Hard and Cum Yusa Minami Yuu Toyoda TACHIBANAKOHARU Emiri Fujisawa

  • amateur uncensored1pondo
    • 2021-03-27
    50 min

    H4610 ki210327 Rrquest

  • amateur uncensoredh4610
    • 2021-04-02
    63 min

    SIRO-4436 [First shot] [Big breasts x fair skin x sensitive] [Extreme fucking with big cocks buried] Sweet sigh that leaks just by kissing. Apparel clerk who shakes non-standard natural huge breasts .. AV application on the net → AV experience shooti

  • amateur censoredbig titsamateursirosiro-4436siro4436siro-4436
    • 2021-04-13
    58 min

    H0930 ki210413 Yamazaki Kana 33years old

  • amateur uncensoredh0930
    • 2021-04-24
    151 min

    [MMKZ-095]Her Filthy Booty's So Fine It Made Me Lose My Mind! Himari Kinoshita

  • himari kinoshita himari hanazawa censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-095MMKZ095mmkz00095
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    163 min

    [MUDR-148]Young 145cm Tall Girl Delivered To Your Doorstep Are You Okay With Me？ Nae Sakuragi

  • nae sakuragi censoredcreampieuniformMUDRmukuMUDR-148MUDR148mudr00148
    • 2021-05-20
    100 min

    [HTHD-186]My Friend's Mother - The Final Chapter - Yuriko Fujitani

  • yuriko fujitani censoredcreampiemature womanHTHDcenter villagejiro fukagawahona zonoHTHD-186HTHD186h-086hthd00186
    • 2021-05-27
    60 min

    1Pondo 052721_001 Welcome To Luxury Spa: Sakura Kojima

  • amateur uncensored1pondo
    • 2021-06-04
    164 min

    [DVDMS-674]Having A Quickie With The Fair-Skinned Big-Assed Cleaning Woman! She Loved My Big Dick So Much She Came Back The Next Day For More 5

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-674DVDMS674dvdms00674
    • 2021-06-26
    134 min

    [HOKS-097]Maniacal Love Sex Doll / Stepmom And Stepson / Adulterous Wife / Artist / Sex Toys / Overflowing Sexual Desire

  • mao tajima kagami sara censoredbig titscosplayHOKSfa prokinzo ogurokkuHOKS-097HOKS097hoks00097
    • 2021-07-07
    27 min

    FC2PPV 1909580 [Individual shooting 44] 21-year-old neat and clean half-striped pie bread cum shot ② Exposure date in uniform

  • amateur uncensoredfc2
    • 2021-07-08
    124 min

    [RCTD-412]Eyeglasses That Turn You Into A Woman. Nenne Ui.

  • first love censoredbig titsschoolgirlRCTDrocketroot yamazakiRCTD-412RCTD4121rctd00412
    • 2021-07-22
    150 min

    [MIFD-170]Fresh Faced Perfect Beauty, Full-Time Kimono-Weating Employee at a Japanese Restaurant in a Famous Hotel. AV DEBUT!! Rima Kamidai.

  • kamidai rima censoredbig titsblowjobMIFDmoodyzmichiru arashiyamamoodyz freshMIFD-170MIFD170mifd00170
    • 2021-07-24
    47 min

    H4610 ki210725 Kayoko Yuge 31years old

  • amateur uncensoredh4610
    • 2021-08-07
    114 min

    [NSFS-016]The Mature Woman, No. 13 - I Fuck A Young Guy And Come Many Times - Miki Mori

  • miki mori censoredmature womanmomNSFSnagae styletomitake taroNSFS-016NSFS016nsfs00016
    • 2021-08-30
    45 min

    292MY-470 Sumire Aihara 2

  • amateur censoredcreampiebig titsmymy-470my470292my-470
    • 2021-09-02
    49 min

    C0930 ki210902 Taeko Kashitani 28years old

  • amateur uncensoredc0930
    • 2021-09-24
    131 min

    [PED-013]What Happens If You Leave 2 People Alone For 7 Hours...As A Result, They Had Sex 13 Times. Yuuri Asada

  • yuri fukada censoredsquirtingsingle workPEDdream ticketichinose kurumiPED-013PED01324ped00013
    • 2021-10-01
    185 min

    [MIRD-213]Other World Harem Soapland Milks You With Succubus, Furry, And Elf Creampies

  • censoredcreampiebig titsMIRDmoodyzdazai chinpomoodyz realMIRD-213MIRD213mird00213
    • 2021-10-02
    227 min

    [SORA-337]A Cum Swallowing Date With A Blowjob Buddy A Meaty And Voluptuous Office Lady Is Seriously Cumming And Pissing Herself Silly! She"s And Exhibitionist, Opening The Golden Shower Floodgates While D***king Down 6 Cum Shots!! Kurumi Tamaki

  • tamaki walnut censoredblowjobsingle workSORAyama to soradenchuuSORA-337SORA337sora00337
    • 2021-10-15
    150 min

    [BLK-524]TOKYO Gal Sexual Services Center, Miyu Oka

  • miyu sakuraka censoredslutsingle workBLKkira kirakira hosi kira black galBLK-524BLK524blk00524
    • 2021-10-21
    483 min

    [FCDSS-017]A Shaved Pussy of a Beautiful Girl with a Super-Minimum Big Breasted Baby Face! A Perfect Compilation of the Best 8 Hours of the First Experiences of Mayoi Arisaka.

  • arisaka mayoi censoredbeautiful girlslutFCDSSfalenofaleno starFCDSS-017FCDSS0171fcdss00017
    • 2021-11-05
    187 min

    [HUNBL-068]Autoerotic Asphyxiophilia

  • censoredcreampiedeepthroatHUNBLhuntergangurionhhh groupHUNBL-068HUNBL068hunbl00068
    • 2021-11-25
    195 min

    [ABW-171]女子マネージャーは、僕達の性処理ペット。 041 美ノ嶋めぐり【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurcosplayabwabw-171abw171abw-171
    • 2021-12-01
    69 min

    324SRTD-0259 Smile Is Too Best Wet Too Iki Too Cheating Woman And Creampie Sex

  • amateur censoredcreampiebig titssrtdsrtd-0259srtd0259324srtd-0259
    • 2021-12-03
    90 min

    467SHINKI-068 “Extreme” [Train Molester] [Home Voyeur] [Sleep Fuck] Dress Girl Pure White P (Aoi Naruse)

  • amateur censoredcreampieamateurshinkishinki-068shinki068467shinki-068
    • 2021-12-07
    69 min

    FC2PPV 2496711 [No Personal Photography] ★ This Time Also The Finest Chestnut Festival ★ Chestnuts To The Pure Innocent Girl I Met With The First Matching App ● Forgive Michiguchi Demon Blame! !! Ai Endo (21 Years Old)

  • amateur uncensoredfc2
    • 2021-12-10
    82 min

    SMUK-079 Hono (Hono Konomi)

  • amateur censoredcreampieamateursmuksmuk-079smuk079smuk-079
    • 2021-12-17
    120 min

    [PRED-364]The Coexistence Of Intelligence And Loving Dicks. My Older Stepsister Has A Weakness For Dicks Despite Her Stuck-Up-Looking Face. An Adult Video Debut. Ryou Tsubaki

  • ryo tsubaki censoredcreampieblowjobPREDpremiumelegancePRED-364PRED364pred00364
    • 2021-12-17
    163 min

    [MUDR-171]Y********l"s Anal Intercourse With A Rich Man"s J... Miyazawa Chiharu Kagami Sara

  • chiharu miyazawa kagami sara censoredcreampieschoolgirlMUDRmukuMUDR-171MUDR171mudr00171
    • 2022-01-01
    135 min

    [OVG-189]Anal Masturbation OVG- 189

  • yurika rui hizuki censoredanalslutOVGglory questOVG-189OVG189ovg00189
    • 2022-01-07
    119 min

    [JUL-834]An Afternoon Of Immortality With My Former Private Tutor Who I Met In My New Neighborhood Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiemature womanJULmadonnajo asagiriJUL-834JUL834jul00834
    • 2022-01-13
    128 min

    [HBAD-607]Young Wife"s Creampie Sex. The Ruined Men, In Their Reverse Resentment, Thrust Their Dicks Into The Hole Of The Wealthy Wife And Give Her Creampies. Yuri Sasahara.

  • yuri sasahara censoredcreampieblowjobHBADhibinonamitaro umababeHBAD-607HBAD6071hbad00607
    • 2022-01-28
    39 min

    FC2PPV 2628185 First Shot! !! Limited Number! [Uncensored] Staying Date With A Kind Beauty Busty Clerk Who Works At A Pet Shop … The First Vaginal Cum Shot In The Sensitive Body Of Fcup That Shakes A Lot! !! (Feature Film)

  • amateur uncensoredfc2
    • 2022-01-28
    85 min

    534IND-025 Female Ana Bitch. Unauthorized Vaginal Cum Shot To A Spear Man Daughter Who Is Accustomed To Playing

  • amateur censoredcreampieamateurindind-025ind025534ind-025
    • 2022-02-18
    120 min

    [HMN-122]Unveiled 20-Year-Old Cute And Stylish S*****t Studying Fashion. Putting On Lewd AV-Style Cosplay For A First-time Creampie. Maina Shiki

  • shiki maina censoredcreampiecosplayHMNhon nakamametaro mamezawaHMN-122HMN122hmn00122
    • 2022-02-19
    45 min

    C0930 ki220220 Mariko Miyazawa 24years old

  • amateur uncensoredc0930
    • 2022-03-01
    149 min

    [DOKS-556]Thicc Ass Hottie"s Intense Grinding Dildo Masturbation 2

  • sumire tamba rima kawahara censoredslutDOKSoffice k 039 ssanagi matsumotoDOKS-556DOKS55636doks00556
    • 2022-03-06
    49 min

    FC2PPV 2701561 [Personal Shooting / Set Sale] Wine Bar Clerk Who Met An Old Man In A Wine Class Complete Version

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored