leg




FC2MEYDKBIHDKASANWAAAMILKVEMADASDSPRDNNPJDASDVENUAUKGSDABNGODFSDSSJUFECJODHUNTBDTT

2019-05-31
240 min

[OKAX-507]The Naughty Chiropractic Massage Parlor Where Office Ladies From Yaesu, Ikebukuro And Shinjuku Squirm With Pleasure. 4 Hours

  • censoredOKAXk m producedick mandokuokazuOKAX-507OKAX50784okax00507
    • 2019-05-17
    181 min

    [ABP-858]Sex OK!？ The Underground Massage Parlor Everyone Is Talking About 09. Sex In A Small Booth. The Tall Woman And Her Beautiful Legs Will Definitely Turn You On. Riona Mana

  • mana rio censoredsingle workABPprestigemasaru pantherabsolutely perfectABP-858ABP858118abp00858
    • 2019-05-17
    103 min

    [XRW-685]My Teacher And I Share An After School Classroom Secret... Mirei Aika

  • aika mirei censoredcreampieblowjobXRWreal worksreal real worksXRW-685XRW685172xrw00685
    • 2019-05-12
    93 min

    FC2PPV 1084878 WA2000-chan Part3! Beautiful leg layer’s raw tactical doll I have been tied up with a prosthetic body [Personal shooting]

  • amateur uncensoredfc2
    • 2019-05-08
    123 min

    [ARM-762]Panty Shot And Footjob Pleasure R*pe Collection

  • yu tomita yuki sakuragi censoredARMaroma planningaromaARM-762ARM762arm00762
    • 2019-04-26
    55 min

    [KWP-001]Bubble Butt Babe In 20 Denier Transparent Pantyhose Asahi Mizuno

  • mizuno chaoyang censoredsingle workKWPk westk westpsKWP-001KWP001h-1339kwp00001
    • 2019-04-22
    357 min

    [DMOW-189]I Got Fucked While She Talked Dirty To Me. 6 Hours

  • ichika kamihata mikimoto nozomi censoredblowjobslutDMOWoffice k smowDMOW-189DMOW18936dmow00189
    • 2019-04-14
    129 min

    [BDA-089]Intruder. Lust For A Stunning Legislator. Karina Nishida

  • nishida karina censoredbdsmsingle workBDAbermuda mousouzokuabashirikkaBDA-089BDA089bda00089
    • 2019-04-14
    125 min

    [MGMQ-035]When A Girlfriend Rapes Her Man An Office Lady Co-Worker With Beautiful Legs Turns The Tables On Her Man In Reverse Man-Woman Sex Lenon Kanae

  • kanae lennon censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-035MGMQ035mgmq00035
    • 2019-04-12
    157 min

    [XRW-667]Hot Ass Tan Gal And Masochist Man Ririna Yamaoka

  • rina yamaoka censoredcreampieslutXRWreal worksreal real worksXRW-667XRW667172xrw00667
    • 2019-04-12
    135 min

    [XRW-668]Beautiful Legs And Pantyhose-Ism. Miori Ayaha

  • ayaba miori censoredsingle workXRWreal worksreal real worksXRW-668XRW668172xrw00668
    • 2019-04-08
    241 min

    [KDMI-028]Raw Fuck Queen Best Collection

  • censoredcreampieKDMImiludopamixKDMI-028KDMI028kdmi00028
    • 2019-04-08
    124 min

    [DPMI-037]Race Queen Lovers Toka Rinne

  • roaring sound censoredsingle workDPMImiludopamixDPMI-037DPMI037dpmi00037
    • 2019-03-30
    153 min

    [JUFE-036]A Voluptuous Woman In A Tight Business Suit! The Dirty Clothed Sex Of An Accomplished, Tall, Beautiful Office Lady Asahi Mizuno

  • mizuno chaoyang censoredbig titsuniformJUFEfitchJUFE-036JUFE036jufe00036
    • 2019-03-28
    70 min

    [GEKI-0023]Straddling Cabin Attendant With Beautiful Legs. The Cabin Attendant Of A Major Airline Company Who Services Men By Riding Them And Getting Creampied, Sumire (27 Years)

  • sumire kurokawa censoredcreampiesingle workGEKIan amazingly rare amateurcinderella 69GEKI-0023GEKI0023geki000023
    • 2019-03-24
    85 min

    FC2PPV 1055304 WA2000-chan Part2! I asked for a beautiful leg layer while looking at various things ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2019-03-22
    240 min

    [OKAX-487]My Neighbor's Wife Is A Former Athlete With A Voluptuous Ass! She Tempts Me In Her Tight Gym Shorts And We Have Adulterous Sex 4 Hours

  • censoredcosplaymature womanOKAXk m producedick mandokuokazuOKAX-487OKAX48784okax00487
    • 2019-03-20
    99 min

    [ARM-746]Don't Look At My Panties! She Fights Back With More Embarrassment! The Schoolgirl "Leg Scissors" My Face With Her Thighs

  • hinano kanzaka miharu kawada anri mita censoreduniformschoolgirlARMaroma planningaromaARM-746ARM746arm00746
    • 2019-03-17
    143 min

    [KTB-015]A Clothed Lady And A Naked Man An Elder Sister In A Tight Dress

  • yurika mari takasugi censoredbig titsslutKTBkahanshin tigers mousouzokukahanshin tigersKTB-015KTB015ktb00015
    • 2019-03-07
    138 min

    [KTB-014]Bukkake! Office Ladies In Business Suits Club 9H

  • ayuha ami censoredsingle workbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-014KTB014ktb00014
    • 2019-03-06
    118 min

    [PRED-137]Wearing Knee High Socks, My Slutty Old Sister Makes Me Cum Over And Over! Mika Kurosaki

  • kurosaki mika censoredcreampieslutPREDpremiumkitorune kawaguchielegancePRED-137PRED137pred00137
    • 2019-03-01
    127 min

    [DOKS-474]Body Wash: Thorough Washing Of A Woman's Body

  • ayami ino jun amemiya censoredbig titsDOKSoffice k sforever youngDOKS-474DOKS47436doks00474
    • 2019-02-22
    240 min

    [OKAX-477]A Must-See For Panty Shot Enthusiasts! A Massage Parlor Where The Girls Unintentionally Provoke You With Panty Shots. 4 Hours

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-477OKAX47784okax00477
    • 2019-02-22
    79 min

    FC2PPV 1039138 WA2000 and erotic! I will disturb the beautiful leg layer a lot ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2019-02-21
    157 min

    [NHDTB-238]Panties Drenched As Molesters Bring Women With Beautiful Legs To Orgasm By Fingering Them Inside Their Pantyhose

  • censoredsquirtingNHDTBnatural highkansukeNHDTB-238NHDTB2381nhdtb00238
    • 2019-02-20
    128 min

    [ARM-741]This Elder Sister With Beautiful Legs Has Me On My Hands And Knees And Unable To Move While She Gives Me A Footjob

  • shinoda yu kanae lennon censoredslutARMaroma planningaromaARM-741ARM741arm00741
    • 2019-02-16
    150 min

    [SSNI-413]Super Beautiful Legs And Miniskirts. A Provocative Esthetician's Amazing, Intimate Lip Treatment. Arina Hashimoto

  • there is hashimoto censoredhandjobsingle workSSNIs1 no 1 stylehirokoji osakiSSNI-413SSNI413ssni00413
    • 2019-02-15
    163 min

    [DOKS-472]Wet Pantyhose Eroticism

  • red orchid miku abe censoredDOKSoffice k somaruDOKS-472DOKS47236doks00472
    • 2019-02-10
    132 min

    [DPMI-035]Race Queen Lovers Yui Hatano

  • yui hatano censoredsingle workDPMImiludopamixDPMI-035DPMI035dpmi00035
    • 2019-02-10
    241 min

    [EQ-441]Asking Amateur Girls Who Can't Say "No" To Do Dirty Things. We Get Them To Play A Game For "Rewards"... Their Naive Reactions Are So Cute!! 38 Sexy Amateurs We Picked Up. 4 Hours

  • censoredbig titsamateurEQbullittshameEQ-441EQ441h-100eq00441
    • 2019-02-08
    108 min

    [ARM-738]Milking White Cum With Black Leather Pants, Extreme Footjobs

  • tsukushika ayaka muto censoredARMaroma planningaromaARM-738ARM738arm00738
    • 2019-02-02
    240 min

    [HUNTA-552]Compulsory Creampie Leg-Locking Sex With A Horny Thirty-Something Big Sister-In-Law In Sexy Pantyhose! I Suddenly Got A New Big Sister-In-Law Thirty-Something Office Lady Who's A Bit Older Than Me. She's A Hard-Working Hyper Big Ti

  • censoredcreampiesisterHUNTAhunterkawajirihhh groupHUNTA-552HUNTA552hunta00552
    • 2019-02-02
    118 min

    [PRED-132]Female Teacher's Temptation Tight Skirt Edition - Yuka Arai

  • yuka arai censoredslutsingle workPREDpremiumkyoseielegancePRED-132PRED132pred00132
    • 2019-01-27
    98 min

    [SKMS-003]The Sexy, Beautiful Legs Of A Tall Girl Around An Engorged Penis. Forcing Our Way Into The Home Of A Perverted Young Wife On A Walk And Fucking Her. Rin Hifumi

  • one thousand three bells censoredsingle workSKMSmercurysukima industriesSKMS-003SKMS003h-1133skms00003
    • 2019-01-26
    171 min

    [JUFE-019]I'm Having Follow-Up Sex And Pounding This Beautiful Babe Until She Spasms In Trembling Orgasmic Ecstasy And Breaks Down Into A Blubbering Mess Sumire Kurokawa

  • sumire kurokawa censoredsingle workJUFEfitchJUFE-019JUFE019jufe00019
    • 2019-01-24
    128 min

    [RCTD-187]In This World, Brainwashed Armpit Baring Crouching Poses Are An Everyday Thing

  • nanako miyamura rino kirishima censoredRCTDrockettaro kanbeRCTD-187RCTD1871rctd00187
    • 2019-01-17
    116 min

    [SSNI-392]The New Female Teacher Was Gang Bang Raped In Front Of Her Fiancee Arina Hashimoto

  • there is hashimoto censoreddeepthroatsingle workSSNIs1 no 1 styleamazing meatSSNI-392SSNI392ssni00392
    • 2019-01-11
    146 min

    [MDB-980]Documentary Featuring Super Fine Office Ladies. 4 Working Women Appear In A Porno For Extra Cash

  • censoredcreampieMDBmedia stationhiroshi nikumarubazookaMDB-980MDB98061mdb00980
    • 2019-01-08
    115 min

    [ARM-730]For Passive Guys Who Want To Jerk Off To Panty Shots. Panty Shots By Request 2

  • nanako miyamura satori fujinami censoredbeautiful girlARMaroma kikakuupdatingaromaARM-730ARM730arm00730
    • 2018-12-29
    182 min

    [SSNI-380]Total Domain: Tempting Glances of Moe Amatsuka's Heavenly, Smooth Thighs

  • angel moe censoredbeautiful girlslutSSNIs1 no 1 stylegoemonSSNI-380SSNI380ssni00380
    • 2018-12-27
    240 min

    [AIMA-001]Footjob Ejaculation. 16 Beautiful Women Jerk You Off With Their Feet Until You Cum. 4 Hours

  • censoredAIMAmercuryanimaAIMA-001AIMA001h-1133aima00001
    • 2018-12-20
    157 min

    [NHDTB-216]Molesting Teachers Make Knee High Schoolgirls Legs Twitch Exposed With Several Egg Vibrators 2

  • censoredschoolgirlNHDTBnatural highkansukeNHDTB-216NHDTB2161nhdtb00216
    • 2018-12-07
    248 min

    [MLSM-014]Beautiful Mature Woman Babes Best Hits Collection Miko Koike 4 Hours A Mind-Blowing Beautiful Madonna!

  • emiko koike censoredcreampiemature womanMLSMmellow moonMLSM-014MLSM014mlsm00014
    • 2018-12-07
    163 min

    [MEAT-017]Voluptuous Thighs In Knee-High Socks Total Domain Momo Shiraishi

  • momo shiraishi censoredsingle workMEATbig fleshy road family daydreamomaruMEAT-017MEAT017meat00017
    • 2018-12-07
    123 min

    [KTB-011]Bukkake! Pantyhose Stockings - I Wore These Pantyhose Stockings With Your Favorite Outfits -

  • the starry sky ayano kato censoredbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-011KTB011ktb00011
    • 2018-11-27
    148 min

    [SKMS-001]Sexy, Beautiful Legs X 178cm Tall X Sweaty. The Lustful Scent Of A Dirty Wife. Yuno Kumamiya

  • yuno kumamiya censoredslutsingle workSKMSmercurysukima industriesSKMS-001SKMS001h-1133skms00001
    • 2018-11-09
    150 min

    [SCOP-565]If I Rub My Erect Dick Against The Ass Of A Slutty And Bossy Office Lady Who Keeps Taunting Me By Flashing Her Panties, Will She Let Me Fuck Her？

  • censoredcreampieSCOPscoopkitorune kawaguchimousouzokuSCOP-565SCOP565h-565scop00565
    • 2018-11-09
    148 min

    [VRTM-390]When We Slipped This Saleslady Who Suddenly Came To Our House Some Aphrodisiacs, She Rubbed Her Black Pantyhose Legs Against My Crotch And Wrapped Her Legs Around Me In A Scissor Lock And Demanded That I Creampie Her! 5

  • kimishima mio otsuki sound censoredcreampieuniformVRTMv r produceeigo mochizukiVRTM-390VRTM390h-910vrtm00390
    • 2018-11-03
    148 min

    [PRED-110]The Total Domain Of An Elder Sister In Knee-High Socks Who Is Giving Me The Golden Shower Slut Treatment Yu Asakura

  • yu asakura censoredslutsingle workPREDpremiumk westelegancePRED-110PRED110pred00110
    • 2018-10-27
    171 min

    [MIDE-592]The Total Domain Temptation Of A Super Horny Elder Sister In Knee-High Socks Tsubomi

  • bud censoredcosplayslutMIDEmoodyzhirokoji osakimoodyz divaMIDE-592MIDE592mide00592
    • 2018-10-25
    152 min

    [RCTD-159]Black Pantyhose Wearing Beautiful Legs Soapland

  • akemi miu tomoka akari censoredRCTDrocketscarecrowRCTD-159RCTD1591rctd00159
    • 2018-10-21
    120 min

    [KAWD-946]The Beautiful, Seductive Girl Who Tempts Me By Flashing Her Panties At Me. Ruru Arisu

  • have censoredschoolgirlslutKAWDkawaiigoemonKAWD-946KAWD946kawd00946
    • 2018-10-19
    112 min

    [MGMJ-031]Pantyhose Beautiful Legs Kitchen Mikan Kururugi

  • mandarin orange censoredslutsingle workMGMJmegamibeautiful goddess fetishMGMJ-031MGMJ031mgmj00031
    • 2018-10-19
    114 min

    [DPMI-032]Gal's Diary Runa Shimotsuki

  • shimotsuki runa censoredcreampiesingle workDPMImiludopamixDPMI-032DPMI032dpmi00032
    • 2018-10-11
    124 min

    [SDDE-553]Squirt! Squirting While Reading The News. The Female Anchor Who Keeps Reading Even When She Pisses Herself.

  • censoredsquirtingSDDEsod createdainanasenzSDDE-553SDDE5531sdde00553
    • 2018-10-11
    181 min

    [FSET-789]Beauty X Desire X Charm. The Allure Of The Pantyhose. Rui Hizuki

  • rui hizuki censoredsingle workFSETakinoriakinoriaknrFSET-789FSET7891fset00789



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored